back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rtca and RCL1

DIOPT Version :9

Sequence 1:	NP_569977.1	Gene:	Rtca / 31175	FlyBaseID:	FBgn0025630	Length:	361	Species:	Drosophila melanogaster
Sequence 2:	NP_005763.3	Gene:	RCL1 / 10171	HGNCID:	17687	Length:	373	Species:	Homo sapiens

Alignment Length:	40	Identity:	13/40 - (32%)
Similarity:	17/40 - (42%)	Gaps:	2/40 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    84 PMGGMGGMSPYGGGMSPYGMGSMGGMGSS--MSFPFMGKK 121
            |..|.|.::..||..|..|....||.|.:  .||...|.:
Human   383 PSRGAGSVTRGGGAQSQRGTPGAGGAGRARGSSFTKFGNR 422

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rtca	NP_569977.1	RNA_3prim_cycl	7..338	CDD:274563	13/40 (33%)
RCL1	NP_005763.3	18S_RNA_Rcl1p	8..371	CDD:274564
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-
Hieranoid	0	0.000	Not matched by this tool.