DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and TEX1

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_014146.1 Gene:TEX1 SGDID:S000005197 Length:422 Species:Saccharomyces cerevisiae

Alignment Length:210 Identity:49/211 (23%)
Similarity:73/211 (35%) Gaps:69/211 (33%)


  Fly  1332 INT----PLTQSVLHKAKGEILQCVEMLIDKMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELC 1392
            :||    ||...:|...|.|.:...:  :.|..|.:..|  .:.||:....|           :.
Yeast   163 VNTCLYDPLGNWLLAATKSEKIYLFD--VKKDHSSVCSL--NISDISQEDND-----------VV 212

  Fly  1393 PAICKFNQISHCAQTRRIAVGANSGNLAIYELRQ---NKCQMIPAHTHPITSLAFSPDGKYLVSY 1454
            .::...|..||      |.:|..||.|||.:.:.   ..|..|.|||.|||.:...|.|:..::.
Yeast   213 YSLAWSNGGSH------IFIGFKSGYLAILKAKHGILEVCTKIKAHTGPITEIKMDPWGRNFITG 271

  Fly  1455 S-------------CAE---NRLSFWQTSTGMFGLGQSQTRCTK--------------------- 1482
            |             |.|   |.|:...|:..:..||:....||:                     
Yeast   272 SIDGNCYVWNMKSLCCELIINDLNSAVTTLDVCHLGKILGICTEDEMVYFYDLNSGNLLHSKSLA 336

  Fly  1483 GYSTAPI----PDVS 1493
            .|.|.|:    ||.|
Yeast   337 NYKTDPVLKFYPDKS 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791
WD40 <449..>607 CDD:225201
WD40 453..>597 CDD:295369
WD40 repeat 513..555 CDD:293791
WD40 repeat 560..596 CDD:293791
WD40 <1395..>1469 CDD:225201 26/93 (28%)
WD40 <1399..1495 CDD:295369 36/140 (26%)
WD40 repeat 1439..1466 CDD:293791 9/43 (21%)
TEX1NP_014146.1 WD40 1..>374 CDD:225201 49/211 (23%)
WD40 repeat 66..109 CDD:293791
WD40 repeat 116..158 CDD:293791
WD40 repeat 163..205 CDD:293791 12/46 (26%)
WD40 repeat 213..249 CDD:293791 11/42 (26%)
WD40 repeat 256..290 CDD:293791 7/34 (21%)
WD40 repeat 298..336 CDD:293791 5/38 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.