DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbcn-3B and RAD28

DIOPT Version :9

Sequence 1:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_010313.3 Gene:RAD28 / 851594 SGDID:S000002437 Length:506 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:38/195 - (19%)
Similarity:66/195 - (33%) Gaps:74/195 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1358 KMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRIAVGANSGNLAIY 1422
            :|||||                           ||   ||||.:    :.:.||.|...|.:.::
Yeast   285 RMQSEI---------------------------LC---CKFNPV----REQIIACGDMEGGVKLW 315

  Fly  1423 ELR------------QNKCQMI------------------PAHTHPITSLAFSPDGKYLVSYSCA 1457
            :||            :|:.:.|                  .||....:.:.::.:|..|.|.. .
Yeast   316 DLRMRNRLYSELKRNKNRFKTINNDDNDDQSDVYFSSNQSKAHLRCCSDIVWNSEGSELCSVG-M 379

  Fly  1458 ENRLSFWQTSTGMFGLGQSQTRCTKGYSTAPIPDVSRLNPMRLA--KLVWINNRTVTLMLADGSE 1520
            :.:|:.|:..|.:.     |......||.....|:||:...:..  :|:|.:.  ..|.:.|..|
Yeast   380 DGKLNVWRPFTEIL-----QPEGLASYSQLGTQDLSRIKYKKRVSRRLLWFDK--FLLCITDNGE 437

  Fly  1521  1520
            Yeast   438  437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791
WD40 <449..>607 CDD:225201
WD40 453..>597 CDD:295369
WD40 repeat 513..555 CDD:293791
WD40 repeat 560..596 CDD:293791
WD40 <1395..>1469 CDD:225201 19/103 (18%)
WD40 <1399..1495 CDD:295369 22/125 (18%)
WD40 repeat 1439..1466 CDD:293791 5/26 (19%)
RAD28NP_010313.3 WD40 1..386 CDD:225201 25/135 (19%)
WD40 repeat 61..102 CDD:293791
WD40 repeat 108..170 CDD:293791
WD40 repeat 198..233 CDD:293791
WD40 repeat 241..279 CDD:293791
WD40 repeat 290..351 CDD:293791 15/94 (16%)
WD40 repeat 362..388 CDD:293791 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.