Sequence 1: | NP_001284797.1 | Gene: | Rbcn-3B / 31155 | FlyBaseID: | FBgn0023510 | Length: | 1525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010313.3 | Gene: | RAD28 / 851594 | SGDID: | S000002437 | Length: | 506 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 195 | Identity: | 38/195 - (19%) |
---|---|---|---|
Similarity: | 66/195 - (33%) | Gaps: | 74/195 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 1358 KMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRIAVGANSGNLAIY 1422
Fly 1423 ELR------------QNKCQMI------------------PAHTHPITSLAFSPDGKYLVSYSCA 1457
Fly 1458 ENRLSFWQTSTGMFGLGQSQTRCTKGYSTAPIPDVSRLNPMRLA--KLVWINNRTVTLMLADGSE 1520
Fly 1521 1520 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbcn-3B | NP_001284797.1 | WD40 | <11..>204 | CDD:225201 | |
WD40 repeat | 20..63 | CDD:293791 | |||
WD40 | <22..202 | CDD:295369 | |||
WD40 repeat | 68..107 | CDD:293791 | |||
WD40 repeat | 118..152 | CDD:293791 | |||
WD40 repeat | 160..204 | CDD:293791 | |||
WD40 repeat | 212..251 | CDD:293791 | |||
WD40 repeat | 406..459 | CDD:293791 | |||
WD40 | <449..>607 | CDD:225201 | |||
WD40 | 453..>597 | CDD:295369 | |||
WD40 repeat | 513..555 | CDD:293791 | |||
WD40 repeat | 560..596 | CDD:293791 | |||
WD40 | <1395..>1469 | CDD:225201 | 19/103 (18%) | ||
WD40 | <1399..1495 | CDD:295369 | 22/125 (18%) | ||
WD40 repeat | 1439..1466 | CDD:293791 | 5/26 (19%) | ||
RAD28 | NP_010313.3 | WD40 | 1..386 | CDD:225201 | 25/135 (19%) |
WD40 repeat | 61..102 | CDD:293791 | |||
WD40 repeat | 108..170 | CDD:293791 | |||
WD40 repeat | 198..233 | CDD:293791 | |||
WD40 repeat | 241..279 | CDD:293791 | |||
WD40 repeat | 290..351 | CDD:293791 | 15/94 (16%) | ||
WD40 repeat | 362..388 | CDD:293791 | 5/26 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4155 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |