DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and wdsub1

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001071237.1 Gene:wdsub1 ZFINID:ZDB-GENE-061110-97 Length:487 Species:Danio rerio

Alignment Length:433 Identity:91/434 (21%)
Similarity:152/434 (35%) Gaps:126/434 (29%)


  Fly   356 NISILQAKQMPPRPLKP--------HVC----------------TSLVEAWSIMDPPPV-GILDQ 395
            :|.:..::.....|..|        |.|                |::|  || ||...: .:|:.
Zfish    33 SICVYSSRDFSELPFSPLSGHGYGVHCCCFSACGQYLASCSTDATTMV--WS-MDTGEIEAVLEH 94

  Fly   396 LSRITESPVKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGH 460
            ..|   |||::.:  :.|..|.||.|..||||.:...|...:.:  .|:..:.|           
Zfish    95 PGR---SPVRVCA--FSPDSSHLVSGGSDGSIALWDFTSRTLRR--TGVVNDTS----------- 141

  Fly   461 RGRVNCLLCPSMIHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESC--- 522
              .|.|...|.       ....::|.....:.||||....|      ||.:....|  ..||   
Zfish   142 --IVACSFTPC-------GQMFITGSTYGDLRLWDLNMNHL------HAEKNAHDL--GVSCAQF 189

  Fly   523 SPRILK----CI------CSVASDHSVTLVSLQERKCVTLASRHLF-----PVVTIKWRPLDDFL 572
            :|:::|    |:      |...|...:.:|||.....:.:...|..     ||::..:.|....|
Zfish   190 APKMMKGTDGCVQFRLASCGQDSLLKIWIVSLLPSAGIKMQLAHTLTGQSAPVLSCAYSPDGQML 254

  Fly   573 IVGCSDGSVYVWQMETGHLDRVLHGMLAEEVLSACDEQAEDGGSGGGGGSNGASASEMGMANPAV 637
            :.|..|.:|.|:|.:.|.|...||  ..:..::||            ..|..|.....|..:.:|
Zfish   255 VSGSVDKTVTVYQADEGVLLYTLH--QHDRYVTAC------------AFSPTAPLIATGSMDKSV 305

  Fly   638 HFFR---GLKSRNMNAIRHATQRGITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLR--------- 690
            :.:|   |..::..:..........|:.::..||::    .::...|...|:..||         
Zfish   306 NIWRMEEGSSAQGKSLPDEKAAFSNTEGRKACGHSR----LMVSEWSEEEVLAWLREEGLEAVTD 366

  Fly   691 ---TNPKDAESHILFFDIEGLIFELHSEEYAQMTPATLESLGV 730
               :|..|.| .:|....|.|..:||           :||||:
Zfish   367 AFKSNNIDGE-ELLSLSKETLSSDLH-----------IESLGL 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791 12/53 (23%)
WD40 <449..>607 CDD:225201 38/176 (22%)
WD40 453..>597 CDD:295369 36/162 (22%)
WD40 repeat 513..555 CDD:293791 11/55 (20%)
WD40 repeat 560..596 CDD:293791 11/36 (31%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
wdsub1NP_001071237.1 WD40 4..309 CDD:238121 70/328 (21%)
WD 1 10..47 2/14 (14%)
WD40 repeat 17..52 CDD:293791 3/19 (16%)
WD40 50..>371 CDD:225201 76/377 (20%)
WD 2 52..93 9/44 (20%)
WD40 repeat 58..96 CDD:293791 9/41 (22%)
WD 3 95..134 14/46 (30%)
WD40 repeat 100..134 CDD:293791 11/38 (29%)
WD 4 137..176 12/65 (18%)
WD40 repeat 143..178 CDD:293791 11/48 (23%)
WD 5 179..227 11/50 (22%)
WD40 repeat 184..236 CDD:293791 11/52 (21%)
WD 6 237..276 11/39 (28%)
WD40 repeat 242..278 CDD:293791 11/36 (31%)
WD 7 279..318 8/51 (16%)
WD40 repeat 284..308 CDD:293791 6/36 (17%)
SAM_WDSUB1 343..414 CDD:188904 16/68 (24%)
SAM 344..409 CDD:197735 16/67 (24%)
RING 418..483 CDD:302633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.