DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbcn-3B and Wdsub1

DIOPT Version :9

Sequence 1:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001366327.1 Gene:Wdsub1 / 72137 MGIID:1919387 Length:475 Species:Mus musculus


Alignment Length:513 Identity:100/513 - (19%)
Similarity:168/513 - (32%) Gaps:168/513 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 LYGHRGRVNCLLCPSMIHSRYEKSHLLSGGIDFAVCLWDL-------YSGSLLHRFCVH------ 508
            |..|...|:|  |      .:..:.|.:..:|..:.|:.|       ||....|.:.||      
Mouse     8 LADHGDDVSC--C------AFSAALLATCSLDKTIRLYSLSDFAELPYSPLKFHTYAVHCCCFSP 64

  Fly   509 AGEITQLLVPPESCSPRILKCICSVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLI 573
            :|.:.      .|||......:.|..|.|::|::......          ||....:.|...:|.
Mouse    65 SGHVL------ASCSTDGTTVLWSSHSGHTLTVLEQPGGS----------PVRVCCFSPDSAYLA 113

  Fly   574 VGCSDGSVYVWQMETGHLDRVLHGMLAEEVLSACDEQAEDGG---SGGGGGS-----------NG 624
            .|.:|||:.:|..:|..|.|.  |.:.:..|.|| ..:.|||   :|..||.           :.
Mouse   114 SGAADGSIALWNAQTYKLYRC--GSVKDSSLVAC-AFSPDGGLFVTGSSGGDLTVWDDRMRCLHS 175

  Fly   625 ASASEMGM-----ANPAVHFFRGLKSRNMNA-------------IRHATQRGITQLQQLQGHNQG 671
            ..|.::|:     ::..:....||:|..:.:             |.......:.....|.||...
Mouse   176 EKAHDLGITCCSFSSQPLSGGEGLQSYQLASCGQDCEIKLWAVTITRVLGFELKYKSTLSGHCAP 240

  Fly   672 NFDFLMKHRSNPL---------VIQG----------------------------LRTNPKDAESH 699
            .......|....|         :|.|                            |.|...|...:
Mouse   241 VLACAFSHDGKMLASGSVDKSVIIHGIGPQSVLHTLTQHTRYVTTCAFAPNTLLLATGSMDKTVN 305

  Fly   700 ILFFDIE-----GLI---FELHSEEYAQ------MTPATLESL-GVHLQNPKDGKS-MHLDASKK 748
            |..||:|     |.:   .:..:||:::      :....||.| |:...|..|||. :||.....
Mouse   306 IWQFDLETPCQAGSMNDPLKHFTEEWSEEDVSVWLRAQGLEDLVGIFRANNIDGKELLHLTKESL 370

  Fly   749 IGDFFNKVKNKAVDVEKILKDKDKHGLVQKFKEKTEIVEKKVQAKVESLQKAVEPHE-------- 805
            .||         :.:|.:       ||..|.....|    :::||::||...: |.|        
Mouse   371 AGD---------LKIESL-------GLRSKVLRSIE----ELRAKMDSLSSGI-PDEFICPITRE 414

  Fly   806 --------------EQQDLKSKIASKMEVTHVMEVAQLLLSLLHSWGLDPHLDKMCET 849
                          |::.::|.|..|...:.:..:|...|.|..:..|...:::..||
Mouse   415 LMKDPVIASDGYSYEREAMESWIHKKKRTSPMTNLALPSLVLTPNRTLKMAINRWLET 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791 1/1 (100%)
WD40 <449..>607 CDD:225201 36/162 (22%)
WD40 453..>597 CDD:295369 34/152 (22%)
WD40 repeat 513..555 CDD:293791 7/41 (17%)
WD40 repeat 560..596 CDD:293791 11/35 (31%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
Wdsub1NP_001366327.1 WD40 4..308 CDD:238121 61/326 (19%)
WD 1 10..47 8/44 (18%)
WD40 repeat 16..52 CDD:293791 8/43 (19%)
WD 2 52..91 10/44 (23%)
WD40 repeat 57..93 CDD:293791 10/41 (24%)
WD 3 95..134 11/48 (23%)
WD40 repeat 101..136 CDD:293791 10/36 (28%)
WD 4 137..176 9/39 (23%)
WD40 repeat 143..177 CDD:293791 8/34 (24%)
WD 5 178..227 6/48 (13%)
WD40 repeat 183..235 CDD:293791 4/51 (8%)
WD 6 236..275 6/38 (16%)
WD40 repeat 241..264 CDD:293791 2/22 (9%)
WD40 repeat 283..307 CDD:293791 3/23 (13%)
SAM_WDSUB1 327..398 CDD:188904 21/90 (23%)
U-box 403..475 CDD:398320 12/71 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.