DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and TEP1

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_009041.2 Gene:TEP1 HGNCID:11726 Length:2627 Species:Homo sapiens

Alignment Length:918 Identity:169/919 (18%)
Similarity:262/919 (29%) Gaps:362/919 (39%)


  Fly    25 VFLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLVGHSAPVLCLVRASLLPENNFLVSSSEN 89
            :|||||  ||....:||.:.||.::       ..|.::...|....:....|.|:...|.:....
Human  1725 LFLSDD--TLFLTAFDGLLELWDLQ-------HGCRVLQTKAHQYQITGCCLSPDCRLLATVCLG 1780

  Fly    90 GEMCTWDLTDGKCMEAVKLPQVHTQIQSYHTANSEDVRLFCIGYYAEIMVMD----PFSLEVIYV 150
            |.:..||...|      :|...||..:|          |.|:.::.|..|:.    ..|:....|
Human  1781 GCLKLWDTVRG------QLAFQHTYPKS----------LNCVAFHPEGQVIATGSWAGSISFFQV 1829

  Fly   151 LSSKVKPDWISAIHVLRPMRRKDDVVLAITTTG----------TVKVWTLTGNENKHAEPIYENE 205
            ...||..|..:....:|        .||....|          .|::|.........|.|.:...
Human  1830 DGLKVTKDLGAPGASIR--------TLAFNVPGGVVAVGRLDSMVELWAWREGARLAAFPAHHGF 1886

  Fly   206 SKEIRCLNAITMNCCAQNQRTVLLVCTKYWQIYDAGDFTVLCSVIAPARERWQGGDFITSDRVML 270
            ......|:|   .|                |:..||:                      ..:|.:
Human  1887 VAAALFLHA---GC----------------QLLTAGE----------------------DGKVQV 1910

  Fly   271 WT---DEGKGYLYKLPANCIPDNKEFHSKSVVRDAPYLYYVLQHAGDKV--------LSCPPAMK 324
            |:   ...:|:|..|..                 :|.|...|...||:|        :.......
Human  1911 WSGSLGRPRGHLGSLSL-----------------SPALSVALSPDGDRVAVGYRADGIRIYKISS 1958

  Fly   325 LLQGAGGQ--------------HNLLRGDSEGYISVWNVPEVPLDNISILQAKQMPPRPLKPHVC 375
            ..|||.||              ..|:.|..:|.:..|.:.|..|.::                  
Human  1959 GSQGAQGQALDVAVSALAWLSPKVLVSGAEDGSLQGWALKECSLQSL------------------ 2005

  Fly   376 TSLVEAWSIMDPPPVGILDQLSRITESPVKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQL 440
                  |            .|||..:..:.|.:|     |..|....||.::.:.|      .||
Human  2006 ------W------------LLSRFQKPVLGLATS-----QELLASASEDFTVQLWP------RQL 2041

  Fly   441 LVGIKQNFSDWPSHQILYGHRGRVNC------------------LLC--------PSMIHS---- 475
            |.. .....|:|....|.||.|.|:|                  |||        |.:|||    
Human  2042 LTR-PHKAEDFPCGTELRGHEGPVSCCSFSTDGGSLATGGRDRSLLCWDVRTPKTPVLIHSFPAC 2105

  Fly   476 --------RYEKSHLL-SGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLL--------------- 516
                    .:.|.:|| |...|.:|.|||..||..|.:|..|...::.:.               
Human  2106 HRDWVTGCAWTKDNLLISCSSDGSVGLWDPESGQRLGQFLGHQSAVSAVAAVEEHVVSVSRDGTL 2170

  Fly   517 ------------VPPES-----CS----PR-------------------------ILKC------ 529
                        :|..|     |:    ||                         :|.|      
Human  2171 KVWDHQGVELTSIPAHSGPISHCAAAMEPRAAGQPGSELLVVTVGLDGATRLWHPLLVCQTHTLL 2235

  Fly   530 -----------------ICSVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLIVGCS 577
                             :.:.:.|.||.|..:.:....|...|....|..:.|.|.....:.|..
Human  2236 GHSGPVRAAAVSETSGLMLTASEDGSVRLWQVPKEADDTCIPRSSAAVTAVAWAPDGSMAVSGNQ 2300

  Fly   578 DGSVYVWQ--------METGHLDRVLHG-------MLAEEVLSACDEQAEDGGSGGGGGSNGASA 627
            .|.:.:||        ...||:..::..       :.|:|.:|....:...|.:.|         
Human  2301 AGELILWQEAKAVATAQAPGHIGALIWSSAHTFFVLSADEKISEWQVKLRKGSAPG--------- 2356

  Fly   628 SEMGMANPAVHFFRGLKSRNMNAIRHATQRGITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLRTN 692
                  |.::|..|.|            |..:..|..|.....|:|..|.|.....|.::     
Human  2357 ------NLSLHLNRIL------------QEDLGVLTSLDWAPDGHFLILAKADLKLLCMK----- 2398

  Fly   693 PKDAESHILFFDIEG-LIFELHSEEYAQMTPATLESLGVHLQNPKDGKSMHLDASKKIGDFFNKV 756
            |.||.|.|.....|. :|...|.|            .|:.:..|||...:.....|:.|:|..::
Human  2399 PGDAPSEIWSSYTENPMILSTHKE------------YGIFVLQPKDPGVLSFLRQKESGEFEERL 2451

  Fly   757 KNKAVDVE 764
             |..:::|
Human  2452 -NFDINLE 2458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 41/193 (21%)
WD40 repeat 20..63 CDD:293791 12/38 (32%)
WD40 <22..202 CDD:295369 41/191 (21%)
WD40 repeat 68..107 CDD:293791 7/39 (18%)
WD40 repeat 118..152 CDD:293791 6/38 (16%)
WD40 repeat 160..204 CDD:293791 8/54 (15%)
WD40 repeat 212..251 CDD:293791 6/39 (15%)
WD40 repeat 406..459 CDD:293791 13/53 (25%)
WD40 <449..>607 CDD:225201 54/296 (18%)
WD40 453..>597 CDD:295369 49/275 (18%)
WD40 repeat 513..555 CDD:293791 12/126 (10%)
WD40 repeat 560..596 CDD:293791 9/44 (20%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
TEP1NP_009041.2 TEP1 N-terminal 1 1..30
TEP1_N 1..29 CDD:283129
TEP1 N-terminal 2 31..60
TEP1_N 31..59 CDD:283129
TEP1 N-terminal 3 61..90
TEP1_N 61..89 CDD:283129
TEP1 N-terminal 4 91..120
TEP1_N 91..119 CDD:283129
TROVE 226..676 CDD:283406
DUF4062 908..1008 CDD:290011
NACHT 1162..1337 CDD:283404
WD 1 1411..1448
WD 2 1674..1713
WD40 1680..1955 CDD:295369 58/321 (18%)
WD40 <1680..1824 CDD:225201 29/124 (23%)
WD40 repeat 1680..1716 CDD:293791
WD 3 1716..1754 12/38 (32%)
WD40 repeat 1722..1757 CDD:293791 12/41 (29%)
WD 4 1757..1796 9/45 (20%)
WD40 repeat 1762..1801 CDD:293791 10/45 (22%)
WD 5 1798..1837 10/49 (20%)
WD40 1799..2190 CDD:225201 91/515 (18%)
WD40 repeat 1804..1840 CDD:293791 8/36 (22%)
WD 6 1840..1879 6/47 (13%)
WD40 repeat 1845..1881 CDD:293791 7/44 (16%)
WD 7 1882..1921 9/80 (11%)
WD40 repeat 1888..1923 CDD:293791 10/76 (13%)
WD 8 1925..1964 10/56 (18%)
WD 9 1967..2005 6/38 (16%)
WD40 1972..2308 CDD:238121 68/384 (18%)
WD40 repeat 1972..2013 CDD:293791 10/77 (13%)
WD 10 2008..2047 13/51 (25%)
WD40 repeat 2016..2059 CDD:293791 13/55 (24%)
WD40 2022..2391 CDD:225201 75/403 (19%)
WD 11 2059..2098 9/39 (23%)
WD40 repeat 2064..2103 CDD:293791 9/39 (23%)
WD 12 2105..2143 12/38 (32%)
WD40 repeat 2111..2145 CDD:293791 13/34 (38%)
WD 13 2146..2183 1/37 (3%)
WD40 repeat 2151..2235 CDD:293791 7/84 (8%)
WD 14 2185..2233 6/48 (13%)
WD40 2231..>2391 CDD:295369 31/187 (17%)
WD 15 2236..2275 5/39 (13%)
WD40 repeat 2241..2280 CDD:293791 6/39 (15%)
WD 16 2278..2317 8/39 (21%)
WD40 repeat 2283..2307 CDD:293791 5/24 (21%)
WD 17 2319..2355 6/36 (17%)
WD40 repeat 2326..2359 CDD:293791 6/48 (13%)
WD 18 2368..2417 14/54 (26%)
WD40 repeat 2372..2418 CDD:293791 14/51 (27%)
WD 19 2459..2500 169/919 (18%)
WD 20 2553..2590
WD 21 2592..2626
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.