DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and Wdr61

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001020546.1 Gene:Wdr61 MGIID:1917493 Length:305 Species:Mus musculus

Alignment Length:286 Identity:62/287 (22%)
Similarity:101/287 (35%) Gaps:60/287 (21%)


  Fly   336 LRGDSEGYISVWNVPEVPLDNISILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRIT 400
            |.|...|.:||.....:|:...|.|.|.               :..|.:.:.      .|:..|.
Mouse    60 LEGHQLGVVSVDISHTLPIAASSSLDAH---------------IRLWDLENG------KQMKSID 103

  Fly   401 ESPVKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGHRGRVN 465
            ..||...:..:.|....|..|...|.:.|.....        |.|:...|.....||        
Mouse   104 AGPVDAWTLAFSPDSQYLATGTHMGKVNIFGVES--------GKKEYSLDTRGKFIL-------- 152

  Fly   466 CLLCPSMIHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESCSPRILKCI 530
                 |:.:|. :..:|.||.||..:.::|:.:|.|||....||..|..|...|:|      :.:
Mouse   153 -----SIAYSP-DGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDS------QLL 205

  Fly   531 CSVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLIVGCSDGSVYVWQMET------- 588
            .:.:.|..:.:..:|........|.|...|:.:.:.|.|...:...||.||.||.:.|       
Mouse   206 VTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTF 270

  Fly   589 -GHLDR---VLHGMLAEEVLSACDEQ 610
             .|.|:   |.:.....:::|..|:|
Mouse   271 FDHQDQVWGVKYNGNGSKIVSVGDDQ 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791 10/53 (19%)
WD40 <449..>607 CDD:225201 39/169 (23%)
WD40 453..>597 CDD:295369 37/155 (24%)
WD40 repeat 513..555 CDD:293791 6/42 (14%)
WD40 repeat 560..596 CDD:293791 13/47 (28%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
Wdr61NP_001020546.1 WD40 13..302 CDD:238121 62/287 (22%)
WD 1 14..57
WD40 repeat 19..62 CDD:293791 1/2 (50%)
WD 2 62..101 10/60 (17%)
WD40 repeat 68..105 CDD:293791 9/58 (16%)
WD 3 104..143 9/47 (19%)
WD40 repeat 110..146 CDD:293791 8/44 (18%)
WD 4 146..187 14/55 (25%)
WD40 repeat 152..188 CDD:293791 13/50 (26%)
WD 5 188..227 8/45 (18%)
WD40 repeat 193..229 CDD:293791 6/42 (14%)
WD 6 230..269 11/39 (28%)
WD40 repeat 236..271 CDD:293791 9/35 (26%)
WD 7 272..305 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.