DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and Wdr7

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_076465.1 Gene:Wdr7 RGDID:619836 Length:1488 Species:Rattus norvegicus

Alignment Length:1602 Identity:654/1603 (41%)
Similarity:959/1603 (60%) Gaps:191/1603 (12%)


  Fly     1 MVSTNLVVPVVLWGPTAPTHCISSVFLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLVGHS 65
            |...:||:|:||||..||||||||:.|:||..|:||||:|||||||.:. ..|:::||.||.||:
  Rat     1 MAGNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICLWDLS-EELEVNPRALLFGHT 64

  Fly    66 APVLCLVRASLLPENNFLVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQIQSYH--TANSEDVRL 128
            |.:.||.:|....:..:.||:|.|||||.||:.||:|:|..||...||.||.|.  ..|..:.||
  Rat    65 AAITCLSKACASGDKQYTVSASANGEMCLWDVNDGRCIEFTKLACTHTGIQFYQFSVGNQREGRL 129

  Fly   129 FCIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRRKDDVVLAITTTGTVKVWTLTGN 193
            .|.|:|.||:|:|..||||:|.|.||:.|||||::.::|..|.::|.|:|::.||.:|||.:|..
  Rat   130 LCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVALSVTGILKVWIVTSE 194

  Fly   194 EN--KHAEPIYENESKEIRCLNAITMNCCAQNQRTVLLVCTKYWQIYDAGDFTVLCSVIAPARER 256
            .:  :..|||:|.|||.|.|.|..:::.||..||::|:||:|||:::||||:::|||..:...:.
  Rat   195 ISGLQDTEPIFEEESKPIYCQNCQSLSFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSEDGQT 259

  Fly   257 WQGGDFITSDRVMLWTDEGKGYLYKLPANCIPDNKEFHS---KSVVRDAPYLYYVLQHAGDK-VL 317
            |.||||:::|:|::||:.|:.|:|||||:|:|.:..|.|   |:|....|.:.:.|....|: ::
  Rat   260 WTGGDFVSADKVIIWTENGQSYIYKLPASCLPASDSFRSDVGKAVENLIPPVQHSLLDQKDRELV 324

  Fly   318 SCPPAMKLLQGAGGQ-HNLL-RGDSEGYISVWNVPEVPLDNISILQAKQMPPRPLKPHVCTSLVE 380
            .|||..:...|.... |.|| :|||.|.:|:||:.::        ..||.....||...|.||.:
  Rat   325 ICPPVTRFFYGCKEYLHKLLIQGDSSGRLSIWNIADI--------ADKQEANEGLKTTTCISLQD 381

  Fly   381 AWSIMDPPPVGILDQLSRITES--PVKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQLLVG 443
            |:..:.|.|.||:||||.|..|  |:|:|:|:|:|...|||.|||||||:|||||||.::|||.|
  Rat   382 AFDKLKPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRLVCGREDGSIIIVPATQTAIVQLLQG 446

  Fly   444 IKQNFSDWPSHQILYGHRGRVNCLLCPSMIHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRFCVH 508
            .......||.|:.|.|||.:|.|||.|..:.:||::.:|:|||:||:|.:||::||.:.|.||||
  Rat   447 EHMLRRGWPPHRTLRGHRNKVTCLLYPHQVSARYDQRYLISGGVDFSVIIWDIFSGEMKHIFCVH 511

  Fly   509 AGEITQLLVPPESCSPRILKCICSVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLI 573
            .|||||||||||:||.|:..|:|||||||||.|:||:|:||:.||||||||:..|||||.||:|:
  Rat   512 GGEITQLLVPPENCSARVQHCVCSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLV 576

  Fly   574 VGCSDGSVYVWQMETGHLDRVLHGMLAEEVLSACDEQAEDGGSGGGGGSNGASASEMGMANPAVH 638
            |||:||||.||||:||.|||...|:.|.|:|:||||              ...|:...:::|||:
  Rat   577 VGCTDGSVCVWQMDTGALDRCAMGITAVEILNACDE--------------AVPAAVDSLSHPAVN 627

  Fly   639 FFRGLKSRNMNAIR----HATQRGITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLRTNPKDAESH 699
            ..:.:..|::.|::    |..|...|.|...:..::||   |.|:..|.|::|.::||..|.:.|
  Rat   628 LKQAMTRRSLAALKNMAHHKLQTLATNLLASEASDKGN---LPKYSHNSLMVQAIKTNLTDPDIH 689

  Fly   700 ILFFDIEGLIFELHSEEYAQMTPATLESLGVHLQNPKDGKSMHLDASKKIGDFFNKVKNKAVDVE 764
            :||||:|.||.:|.:||.::...|.:....:...:....|.......|:....|.:||       
  Rat   690 VLFFDVEALIIQLLTEEASRPNTALISPENLQKASGSSDKGGSFLTGKRAAVLFQQVK------- 747

  Fly   765 KILKDKDKHGLVQKFKEKTEIVEKKVQAKVESLQKAVEPHEEQQDLKSKIASKMEVTHVMEVAQL 829
            :.:|:..|..|:.:.:::.|::.          |:..|...|.:..|||..:.:|....|:.|:|
  Rat   748 ETIKENIKEHLLDEEEDEEEVMR----------QRREESDPEYRASKSKPLTLLEYNLTMDTAKL 802

  Fly   830 LLSLLHSWGLDPHLDKMCETRLGLLRPIVPISYGVLSKAGYMSLLLPTWQNNYAIPPGIQLPS-S 893
            .:|.||:|||:..||::|..|||:|:|...:|:|:||:.|:|||:||.:  |.|....:|..: :
  Rat   803 FMSCLHAWGLNEVLDEVCLDRLGMLKPHCTVSFGLLSRGGHMSLMLPGY--NQAAGKLLQAKAEA 865

  Fly   894 SKKRPLPEELQRLEHLTAVFTSRLHWELSTTLTTNHILALVAMSNTLLSMSAASFLPDSEKHKKL 958
            .:|.|..|.:.:     ..:|      :|..:||.|:|::::::|||:||:.|:|:.|..| |..
  Rat   866 GRKGPATESVGK-----GTYT------VSRAVTTQHLLSIISLANTLMSMTNATFIGDHMK-KGP 918

  Fly   959 QRLAQRTDSTLSNEEEREELMAHHI-SQIKHA-------------------------------WS 991
            .|..:.....||...:.....::.: .|||.|                               ||
  Rat   919 TRPPRPGTPDLSKARDSPPASSNIVQGQIKQAAAPVSARSAADHSGSASASPALRTCFLVNEGWS 983

  Fly   992 LLATHHCFLLPDKIEALEPKKFKRPQVEMMVKRWQHHCIEIREAAQQILLGELTRMGKKGRKQLV 1056
            .||..||.:|||   .|...||:.|.:||:.:|||..|:|:|||||.:||.||.|:.:.|||:.:
  Rat   984 QLAAMHCVMLPD---LLGLGKFRPPLLEMLARRWQDRCLEVREAAQALLLAELRRIEQAGRKETI 1045

  Fly  1057 ESWAQYLPLY-THT-EPIVGAQQQLALISQPASGGAGSGSGGNGGVGVGVSGGGGAGSGSGPGGS 1119
            ::||.|||.| .|. .|.|.|:....:.:.|                          ..|||...
  Rat  1046 DTWAPYLPQYMDHVISPGVTAEAMQTMAAAP--------------------------DASGPEAK 1084

  Fly  1120 VPGGDAHQDEDYEEEEEEI----------IRKPSSLSELKRKQTTAVILLGVIGAEFGQDISQES 1174
            |      |:|:::..:::|          ::|.|:..|.:|||.||::||||||||||.:|  |.
  Rat  1085 V------QEEEHDLVDDDITTGCLSSVPQMKKMSTSYEERRKQATAIVLLGVIGAEFGAEI--EP 1141

  Fly  1175 PNHRGSISMATGANLTSGVAGGERRKSSVVEGFGIAN-----NLARLTSMALAHLLYAPPSPKLP 1234
            |.                :....|..|.:.||||:.:     :|||.|..||..||..|||||||
  Rat  1142 PK----------------LLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLP 1190

  Fly  1235 QYTPLRRAAIDLLGRGFTVWEPYLDVSKVLLGLLEISCEG-KAVPNLNYKLPLTPQADACRTARH 1298
            .::.:||.||||:||||||||||:|||.||:||||:..:. |.:.|:...|||:|.||:.|:|||
  Rat  1191 PHSTIRRTAIDLIGRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARH 1255

  Fly  1299 ALRLIATARPAAFITTMAREVARYNTM---QQNAQSINTPLTQSVLHKAKGEILQCVEMLIDKMQ 1360
            ||.|||||||.|||||:|:||.|:..:   .|:.|||:|    :.|.:||||||:.:|:||:||.
  Rat  1256 ALSLIATARPPAFITTIAKEVHRHTALAANTQSQQSIHT----TTLARAKGEILRVIEILIEKMP 1316

  Fly  1361 SEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRIAVGANSGNLAIYELR 1425
            :::..||||||||.::|::|:.:|.:||.|..||||:|..:|:..::.||||||..|::|:|::|
  Rat  1317 TDVVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERSHRIAVGARHGSVALYDIR 1381

  Fly  1426 QNKCQMIPAHTHPITSLAFSPDGKYLVSYSCAENRLSFWQTSTGMFG-LGQ----SQTRCTKGYS 1485
            ..|||.|..|..|||:::|:|||:||.:||..::.:||||.:|.:.| :|.    .|.||.|.|.
  Rat  1382 TGKCQTIHGHKGPITAVSFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQ 1446

  Fly  1486 TAPIPDVS--RLNPMRLAKLVWINNRTVTLMLADGSETRFNV 1525
            ..|:...|  ..|.:|||:|:|.:||.|.||..||.|.||.|
  Rat  1447 VPPVQPASPGSHNALRLARLIWTSNRNVILMAHDGKEHRFMV 1488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 97/197 (49%)
WD40 repeat 20..63 CDD:293791 25/43 (58%)
WD40 <22..202 CDD:295369 87/184 (47%)
WD40 repeat 68..107 CDD:293791 17/39 (44%)
WD40 repeat 118..152 CDD:293791 17/36 (47%)
WD40 repeat 160..204 CDD:293791 17/46 (37%)
WD40 repeat 212..251 CDD:293791 18/39 (46%)
WD40 repeat 406..459 CDD:293791 29/53 (55%)
WD40 <449..>607 CDD:225201 97/158 (61%)
WD40 453..>597 CDD:295369 90/144 (63%)
WD40 repeat 513..555 CDD:293791 30/42 (71%)
WD40 repeat 560..596 CDD:293791 24/36 (67%)
WD40 <1395..>1469 CDD:225201 35/74 (47%)
WD40 <1399..1495 CDD:295369 41/103 (40%)
WD40 repeat 1439..1466 CDD:293791 14/27 (52%)
Wdr7NP_076465.1 WD 1 17..56 24/40 (60%)
WD40 <19..199 CDD:225201 87/181 (48%)
WD40 <19..102 CDD:295369 45/84 (54%)
WD40 repeat 22..62 CDD:293791 23/41 (56%)
WD 2 62..104 20/42 (48%)
WD40 repeat 68..109 CDD:293791 19/41 (46%)
WD40 repeat 114..153 CDD:293791 19/39 (49%)
WD 3 156..199 16/43 (37%)
WD40 repeat 162..208 CDD:293791 16/46 (35%)
WD 4 324..366 16/50 (32%)
WD40 341..>592 CDD:225201 143/259 (55%)
WD40 repeat 393..461 CDD:293791 38/68 (56%)
WD 5 404..443 24/39 (62%)
WD40 407..>594 CDD:295369 115/187 (61%)
WD 6 462..507 22/45 (49%)
WD40 repeat 468..522 CDD:293791 31/54 (57%)
WD 7 558..597 29/39 (74%)
WD40 repeat 563..589 CDD:293791 18/26 (69%)
WD 8 1349..1388 19/39 (49%)
WD40 repeat 1354..1390 CDD:293791 16/36 (44%)
WD40 <1355..1424 CDD:295369 31/69 (45%)
WD40 <1363..>1482 CDD:225201 53/119 (45%)
WD 9 1390..1430 18/40 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C341258294
eggNOG 1 0.900 E1_KOG4155
Hieranoid 1 1.000
Homologene 1 1.000 H11408
Inparanoid 1 1.050 1148 1.000 Inparanoid score I195
OMA 1 1.010
OrthoDB 1 1.010 D331603at33208
OrthoFinder 1 1.000 FOG0004780
OrthoInspector 1 1.000 T1089194
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR44099
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.