DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and apaf1

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_571683.1 Gene:apaf1 ZFINID:ZDB-GENE-000616-4 Length:1261 Species:Danio rerio

Alignment Length:653 Identity:111/654 (17%)
Similarity:201/654 (31%) Gaps:263/654 (40%)


  Fly    28 SDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLVGHSAPV--LCLVRASLLPENNFLVSSSENG 90
            |:|:||        ...||...    |.:.:..:.||..||  .|     ..|.:.:|.:||.:|
Zfish   723 SNDKFT--------NTRLWNPN----KKTSQNTMFGHMEPVNHCC-----FSPNDLYLATSSSDG 770

  Fly    91 EMCTWDLTDGKCMEAVKLPQVHTQIQSYHTANSEDVRLF--CIGYYAE-----------IMVMDP 142
            .:..::::.....:::       .:.|:...:.|:::..  |..:.|:           :.|.|.
Zfish   771 SLKLFEVSSANEWKSI-------DVDSFFPESDEEIKAMVKCSTWSADGSQIICAARNTVFVFDV 828

  Fly   143 FSLEVIYVLSSKVKPDWISAIHVLRPMRRKDDVVLAITTTGTVKVWTLTGNENKHAEPIYENESK 207
            .:.:::.    |:|...:|.|...........:.:|::.. ||::|.            :|:..|
Zfish   829 ETSDLLL----KLKTSRLSTIQFCHACPNSSLLAVALSHY-TVELWN------------FESSKK 876

  Fly   208 EIRCLNAITMNCCAQNQRTVLLVCTKYWQIYDAGDFTVLCSVIAPARERWQGGDFITSD--RVML 270
            :..|...::...|.|                .:.|.::|.|               :||  .:.|
Zfish   877 KAECSGHLSWVHCVQ----------------FSPDGSLLLS---------------SSDDQTIRL 910

  Fly   271 WTDEGKGYLYKLPANCIPDNKEFHSKSVV---RDAPYLYYVLQHAGDKVLSCPPAMKLLQGAGGQ 332
            |                 :....|:.|.|   ||..    ||....|..:..|.:...||...| 
Zfish   911 W-----------------ETDRVHTSSAVALKRDTD----VLSSHSDATIIAPDSSNRLQVLSG- 953

  Fly   333 HNLLRGDSEGYISVWNVPEVPLDNISILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLS 397
                   |.|.:              :|:::::.                              |
Zfish   954 -------STGAV--------------VLESEELS------------------------------S 967

  Fly   398 RITESPVKLTSSIYLPQQSRLVIGREDGSIVI--VPA----------TQTVM-------MQLLVG 443
            ||..|.:...::.       :.:|.|||::.:  ||:          |:||.       .::|:.
Zfish   968 RIRCSCISRNAAF-------VALGSEDGTVQVIEVPSSKASVKLSGHTKTVHHCQFTDDCEILIT 1025

  Fly   444 IKQNFS----DWPSHQ--ILYGHRGRVNCLLCPSMIH--SRYEKSHLLSGGIDFAVCLWDLYSGS 500
            ..::.:    .|.:.:  :|.||...|.      ..|  |.....||.|...|..|.:|||..|.
Zfish  1026 SSEDSTIRVWKWRTGECMVLQGHMEPVR------KFHLLSSSSSPHLFSWSFDGTVKVWDLTRGQ 1084

  Fly   501 LLHRFCVHAGEITQLLVPPESCSPRILKCICSVASDHSVTLVSLQERKCVTLASRHLFPVVTIKW 565
            :|.....|.|.:..                |.|:||..:...:...|.....:|        ..|
Zfish  1085 MLQDLVCHEGAVLS----------------CDVSSDGRLFATTSANRTAKVWSS--------ASW 1125

  Fly   566 RPLDDFLIVGCSD--------------------GSVYVWQMETGHLDRVLHGMLAEEVLSACDEQ 610
            :.|  ||:.|..|                    |.:.:|.|..|.|            |..|...
Zfish  1126 KML--FLLEGHKDCVRSCRFSWDNKRLATGDDNGEIRLWSMLDGAL------------LKICPRD 1176

  Fly   611 AED 613
            .:|
Zfish  1177 TKD 1179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 32/191 (17%)
WD40 repeat 20..63 CDD:293791 7/35 (20%)
WD40 <22..202 CDD:295369 31/189 (16%)
WD40 repeat 68..107 CDD:293791 7/41 (17%)
WD40 repeat 118..152 CDD:293791 5/47 (11%)
WD40 repeat 160..204 CDD:293791 7/44 (16%)
WD40 repeat 212..251 CDD:293791 5/39 (13%)
WD40 repeat 406..459 CDD:293791 12/78 (15%)
WD40 <449..>607 CDD:225201 37/186 (20%)
WD40 453..>597 CDD:295369 35/168 (21%)
WD40 repeat 513..555 CDD:293791 6/42 (14%)
WD40 repeat 560..596 CDD:293791 11/56 (20%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
apaf1NP_571683.1 DD 7..92 CDD:301326
NB-ARC 132..411 CDD:279299
P-loop_NTPase 150..297 CDD:304359
WD 1 615..654
WD40 616..912 CDD:238121 43/278 (15%)
WD40 repeat 625..657 CDD:293791
WD40 641..1042 CDD:225201 73/471 (15%)
WD 2 657..696
WD40 repeat 663..699 CDD:293791
WD 3 700..743 7/32 (22%)
WD40 repeat 705..745 CDD:293791 7/34 (21%)
WD 4 746..785 10/44 (23%)
WD40 repeat 752..796 CDD:293791 7/56 (13%)
WD 5 798..836 4/42 (10%)
WD40 repeat 803..841 CDD:293791 6/42 (14%)
WD 6 840..879 8/52 (15%)
WD40 851..1256 CDD:225201 84/498 (17%)
WD40 877..1212 CDD:238121 78/459 (17%)
WD 7 882..921 11/87 (13%)
WD40 repeat 887..911 CDD:293791 8/55 (15%)
WD40 repeat 960..1005 CDD:293791 11/82 (13%)
WD 8 964..1003 10/76 (13%)
WD 9 1006..1045 5/39 (13%)
WD40 repeat 1011..1046 CDD:293791 4/35 (11%)
WD 10 1047..1088 15/47 (32%)
WD 11 1091..1130 11/65 (17%)
WD40 repeat 1096..1132 CDD:293791 10/62 (16%)
WD 12 1133..1172 8/51 (16%)
WD40 repeat 1138..1162 CDD:293791 1/24 (4%)
WD 13 1184..1223
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.