DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and dcaf10

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001015742.2 Gene:dcaf10 XenbaseID:XB-GENE-967155 Length:457 Species:Xenopus tropicalis

Alignment Length:382 Identity:84/383 (22%)
Similarity:136/383 (36%) Gaps:106/383 (28%)


  Fly    10 VVLWGPTAPTH----------CISSV-FLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLVG 63
            |:|:.|.:..|          |:::: ||.:..|  .|...|..|.||.:.....|:   |.|.|
 Frog    91 VLLFDPVSSKHIKTLSEAHEDCVNNIRFLDNRMF--ATCSDDTTIALWDLRKLNSKV---CTLHG 150

  Fly    64 HSAPVLCLVRASLLPENN--FLVSSSENGEMCTWD---LTDGKCMEAVKLPQVHTQIQSYHTANS 123
            |::.|     .::..:.|  .||:|..:|.:..||   .|:..|        .|.:.  :||...
 Frog   151 HTSWV-----KNIEYDTNTRLLVTSGFDGNVIIWDTNRCTEDGC--------PHKKF--FHTRFL 200

  Fly   124 EDVRLF--C--------IGYYAEIMVMD-PFSLEVIYVLSSKVKPDWISAIHVLRPMRRKDDVVL 177
            ..:||.  |        .||...:..:| ..||||             .:..:||..|......:
 Frog   201 MRMRLTPDCSKMLISTSSGYLLILHELDLTKSLEV-------------GSYPILRARRTASTSDM 252

  Fly   178 AITTTGTVKVWTLTGNEN------KHAEPIYENESKEIR-CLNAITMNCCAQNQRTVLLVCTKYW 235
            ..|::.|....:...|.:      ||.....:.|....| .|..:|.....:..|.   .|....
 Frog   253 TSTSSDTRPSSSPCHNSDLGPLFEKHMSRSSQREGASPRNSLEVLTPEVPGERDRG---NCITSL 314

  Fly   236 QIYDAGDFTVL-CSVIAPARE-----RWQGGDFI------TSDRVMLWTDE---GKGYLYKLPAN 285
            |::..|..|:| ||.....:|     .:|.|..:      .|.|:..:.:|   |:||:.:|   
 Frog   315 QLHPKGWATLLRCSSNTDDQEWTCVYEFQEGAPVRQVSPRCSLRLTHYIEEANVGRGYIKEL--- 376

  Fly   286 CI-PDNKEFHSKSVVRDAPYLYYVLQHAGDKVL----SCPPAMKLLQGAGGQHNLLR 337
            |. ||.:...|       ||.|      |.::|    .|...:..|....|...::|
 Frog   377 CFSPDGRMIAS-------PYAY------GIRLLGFDSQCKELVDCLPKEAGTLQVIR 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 48/226 (21%)
WD40 repeat 20..63 CDD:293791 13/54 (24%)
WD40 <22..202 CDD:295369 44/203 (22%)
WD40 repeat 68..107 CDD:293791 10/44 (23%)
WD40 repeat 118..152 CDD:293791 12/45 (27%)
WD40 repeat 160..204 CDD:293791 8/50 (16%)
WD40 repeat 212..251 CDD:293791 10/40 (25%)
WD40 repeat 406..459 CDD:293791
WD40 <449..>607 CDD:225201
WD40 453..>597 CDD:295369
WD40 repeat 513..555 CDD:293791
WD40 repeat 560..596 CDD:293791
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
dcaf10NP_001015742.2 WD40 <63..218 CDD:295369 34/147 (23%)
WD 1 65..104 4/13 (31%)
WD40 <70..>218 CDD:225201 34/147 (23%)
WD40 repeat 71..106 CDD:293791 4/15 (27%)
WD 2 108..146 10/43 (23%)
WD40 repeat 113..149 CDD:293791 11/41 (27%)
WD 3 150..189 11/44 (25%)
WD40 repeat 155..181 CDD:293791 8/31 (26%)
WD 4 195..234 10/39 (26%)
WD 5 306..346 11/43 (26%)
WD 6 368..406 14/54 (26%)
WD40 repeat 373..423 CDD:293791 14/65 (22%)
WD40 415..453 CDD:197651 1/7 (14%)
WD 7 424..457
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.