DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and wdr32

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_998111.2 Gene:wdr32 ZFINID:ZDB-GENE-040426-2314 Length:508 Species:Danio rerio

Alignment Length:372 Identity:76/373 (20%)
Similarity:129/373 (35%) Gaps:122/373 (33%)


  Fly    10 VVLWGPTAPTH----------CISSVFLSDDQFTLVTGCYDG-QICLWQVEPTTLKMSPRCLLVG 63
            |:|:.|.:..|          |::::...|::  |...|.|. .|.||.:.....|:   |.|.|
Zfish   152 VLLFDPVSSRHIKTLVEAHEDCVNNIRFLDNR--LFATCSDDTTIALWDLRKLNSKV---CSLHG 211

  Fly    64 HSAPVLCLVRASLLPENNFLVSSSENGEMCTWD---LTDGKCMEAVKLPQVHTQIQSYHTANSED 125
            |::.|..:...:   ....||:|..:|.:.|||   .|:..|        .|.:.  :||.....
Zfish   212 HASWVKNIEYDT---HTRLLVTSGFDGNVITWDTNRFTEDGC--------PHKKF--FHTRYLMR 263

  Fly   126 VRLF--C--------IGYYAEIMVMD-PFSLEVIYVLSSKVKPDWISAIHVLRPMRRKDDVVLAI 179
            :||.  |        .||...:..:| ..||||             .:..:||..|.      .:
Zfish   264 MRLTPDCSKMLISTSSGYLLILHDLDLTQSLEV-------------GSYRILRARRP------PL 309

  Fly   180 TTTGTV-------KVWTLTGNENKHAEPIYENESKEI------------RCLNAI--------TM 217
            :|.|:.       ...|:....:.|.|.:....|.|:            .|:.::        |:
Zfish   310 STEGSSAGSRSGGPRHTIDNKNHPHREGLSPRNSLEVLTPEIPGERDRGNCITSLQLHPKGWATL 374

  Fly   218 NCCAQNQRTVLLVCTKYWQIYDAGDFTVLCSVIAPARERWQGGDFITSDRVMLWTDE---GKGYL 279
            ..|:.|.......|     :|:..:.......::|.          .|.|:..:.:|   |:||:
Zfish   375 LRCSSNMDDQEWTC-----VYEFQEGAPPRPPVSPR----------CSLRLTHYIEEANVGRGYI 424

  Fly   280 YKLPANCI-PDNKEFHSKSVVRDAPYLYYVLQHAGD----KVLSCPP 321
            .:|   |. ||.:...|       ||.|.|...|.|    :::.|.|
Zfish   425 KEL---CFSPDGRLICS-------PYGYGVRLLAFDENCAELVDCMP 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 47/225 (21%)
WD40 repeat 20..63 CDD:293791 12/54 (22%)
WD40 <22..202 CDD:295369 43/202 (21%)
WD40 repeat 68..107 CDD:293791 10/42 (24%)
WD40 repeat 118..152 CDD:293791 12/45 (27%)
WD40 repeat 160..204 CDD:293791 8/51 (16%)
WD40 repeat 212..251 CDD:293791 5/47 (11%)
WD40 repeat 406..459 CDD:293791
WD40 <449..>607 CDD:225201
WD40 453..>597 CDD:295369
WD40 repeat 513..555 CDD:293791
WD40 repeat 560..596 CDD:293791
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
wdr32NP_998111.2 WD 1 126..165 4/13 (31%)
WD40 <129..279 CDD:295369 33/145 (23%)
WD40 <131..>294 CDD:225201 37/160 (23%)
WD40 repeat 132..167 CDD:293791 4/15 (27%)
WD 2 169..207 9/43 (21%)
WD40 repeat 174..210 CDD:293791 10/41 (24%)
WD 3 211..250 11/42 (26%)
WD40 repeat 216..242 CDD:293791 8/29 (28%)
WD 4 256..295 10/39 (26%)
WD40 repeat 261..288 CDD:293791 5/27 (19%)
WD 5 356..396 6/45 (13%)
WD 6 419..457 14/48 (29%)
WD 7 475..508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.