DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbcn-3B and rig

DIOPT Version :10

Sequence 1:NP_569960.2 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_611499.3 Gene:rig / 37335 FlyBaseID:FBgn0250850 Length:1235 Species:Drosophila melanogaster


Alignment Length:34 Identity:8/34 - (23%)
Similarity:15/34 - (44%) Gaps:2/34 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EERDYSKILTFKPIVFYEKANETG--PHLYLENH 176
            ::..|..:|.:....|...:..||  |.|.:.|:
  Fly    19 QQHSYCWLLAWISAAFLLASRHTGIMPCLNVRNN 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_569960.2 WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:475233 8/34 (24%)
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791 1/6 (17%)
WD40 repeat 160..204 CDD:293791 6/19 (32%)
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791
WD40 453..>597 CDD:475233
WD40 repeat 513..555 CDD:293791
WD40 repeat 560..596 CDD:293791
GvpP <735..816 CDD:444004
WD40 <1408..>1469 CDD:441893
WD40 repeat 1439..1466 CDD:293791
rigNP_611499.3 WD40 repeat 116..160 CDD:293791
WD40 repeat 167..204 CDD:293791
WD40 446..719 CDD:475233
WD40 613..874 CDD:475233
WD40 repeat 617..654 CDD:293791
WD40 repeat 659..691 CDD:293791
WD40 repeat 693..732 CDD:293791
WD40 repeat 744..785 CDD:293791
WD40 repeat 793..831 CDD:293791
WD40 repeat 838..861 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.