DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and rig

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_611499.3 Gene:rig FlyBaseID:FBgn0250850 Length:1235 Species:Drosophila melanogaster

Alignment Length:844 Identity:164/845 (19%)
Similarity:257/845 (30%) Gaps:314/845 (37%)


  Fly   377 SLVEAWSIMDPPPVGILDQ------LSRITES-----PVKLTSSIYL----PQQSRLVIGREDGS 426
            ::.|....|:...:|..|:      :|::|.|     .|.::|::|.    |....|..|..||:
  Fly   572 AMAECPDDMNKIALGCSDRRVAFFDISKLTTSCLPIDSVYVSSNVYCLAWSPNCLELAFGTFDGT 636

  Fly   427 IVIVPATQ-TVMMQLLVGIKQNFSD--WPSHQILYGHRGR----------------VNCLLCPSM 472
            :.|:...: .|...|....|:....  |..| .:|....|                |||:..||.
  Fly   637 VGILDVERMKVKTHLRTPHKKEVYSLVWQDH-FIYFIVNRVLGFFDLRKSKIEPTIVNCISRPSY 700

  Fly   473 IHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESCSPRILKCICSVASDH 537
            :..|  .|.|..|..|..:.:.:..||.                  .:|.||.|.:.        
  Fly   701 LSIR--DSFLFVGTDDGLLQIHERDSGM------------------EKSWSPFIRQS-------- 737

  Fly   538 SVTLVSLQERKCVTLASRHLFPVVTIKWRPLDD--FLIVGCSDGSVYVWQME-TGHLDRVLHGML 599
                         .|.:|:   |..|.|.|||.  |.:.| :|.||||.:.: |....:.||...
  Fly   738 -------------ALFARY---VTDIAWCPLDSNKFAVSG-NDRSVYVMEFQPTERNWKTLHTFT 785

  Fly   600 AEEVLSACDEQAEDGGSGGGGGSNGASASEMGMANPAVHFFRGLKSRNMNAIRHATQRGITQLQQ 664
            |                      |...||                              ||.:: 
  Fly   786 A----------------------NTEKAS------------------------------ITSMR- 797

  Fly   665 LQGHNQGNFDFLMKHRSNPLVIQGLRTNPKDAESHILFFDIEG--------------LIFELHSE 715
             ..|.|       ||.                   :|.|.|||              |....|..
  Fly   798 -WSHTQ-------KHL-------------------LLTFHIEGKVCLWNCNAPEKPPLTITYHCP 835

  Fly   716 EYAQMTPATLE--------SLGVHLQNPKDG-----KSM--HLD-------ASKKIGDFFNKV-- 756
            .:..|...|.|        :|.|.|.:.||.     ||:  .:|       |||.:...:..|  
  Fly   836 MWCGMFLPTNENIIMCSGKALSVELIDIKDALEGDEKSICPKVDALLNVKWASKSLTQPYAPVLT 900

  Fly   757 -----------KNKAVDVEKILKDKDKHGLVQKFKEK-TEIVEKKVQAK------VESLQKAVEP 803
                       :..|..:|..:.:||:    :|.:|. |.:::.....|      ||.:.:|:..
  Fly   901 AAEKKRQRRDQRKAAAKLEVDVANKDQ----KKIQESVTAVIDNPTNDKCTQETPVEEMLEALSL 961

  Fly   804 HEEQQDLKSKIASKMEVTHVMEVAQLLLSLLHSWGLDPHLDKMCETRLGLLRPIVPISYGVLSKA 868
            .:||.:..:|...|.:       .|...|..||                  |..:.::...|:|:
  Fly   962 DKEQNNRSAKECPKCK-------EQSPDSFTHS------------------RTCLYLTQKELNKS 1001

  Fly   869 GYMSLLLPTWQNNYAIPPGIQLPS--SSK---KRPLPEELQRLEH---------LTAVFTSRLHW 919
            ....|.:...:::..|...:.:..  |||   |..:..||..|:|         ..|:.|.:|..
  Fly  1002 ALEKLAIVLTEDSAKIDKSVLISKLFSSKVMAKELIATELTNLKHSNTKDIAPLCLAMSTFKLRE 1066

  Fly   920 EL-----STTLTTNHILALVAMSNTLLSMSAASFLPDSEK-----HKKLQRLAQRTDST-----L 969
            ||     :.|||..|:....::|.||......::....|:     |......:|...|.     |
  Fly  1067 ELEQHIANKTLTERHVSLAPSVSFTLWQDCCRAYAKQMEEKGYIMHAATYLFSQGMQSEAIKLFL 1131

  Fly   970 SNEEEREELMAHHISQIKHAWSLLATHHCFLLPDKIEALEPKKFKRPQVEMMVKRWQHHCIEIRE 1034
            :||..:|.|:...|              |....|            |.::.::..|..|......
  Fly  1132 ANEYYKEALVHARI--------------CLPATD------------PLIKTVINNWLEHLEGTGN 1170

  Fly  1035 AAQQILLGELTRMGKKGRKQLVESWAQYLPLYTHTEP-IVGAQQQLALISQPASGGAGSGSGGN 1097
            .|...|:..|.....:|        ..||..|.:..| |.....|:..|.|  .||...|...|
  Fly  1171 FAAAALICVLDNEMLRG--------YSYLRKYRNCTPEIADLMDQIKRIGQ--LGGVLDGCAPN 1224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791 14/60 (23%)
WD40 <449..>607 CDD:225201 39/179 (22%)
WD40 453..>597 CDD:295369 37/163 (23%)
WD40 repeat 513..555 CDD:293791 5/42 (12%)
WD40 repeat 560..596 CDD:293791 15/39 (38%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
rigNP_611499.3 WD40 <80..>215 CDD:295369
WD40 80..>215 CDD:225201
WD40 repeat 116..160 CDD:293791
WD40 repeat 167..204 CDD:293791
WD40 434..821 CDD:225201 72/375 (19%)
WD40 446..719 CDD:295369 33/150 (22%)
WD40 613..874 CDD:295369 76/387 (20%)
WD40 repeat 617..654 CDD:293791 9/37 (24%)
WD40 repeat 659..691 CDD:293791 4/33 (12%)
WD40 repeat 693..732 CDD:293791 13/59 (22%)
WD40 repeat 744..785 CDD:293791 16/42 (38%)
WD40 repeat 793..831 CDD:293791 12/66 (18%)
WD40 repeat 838..861 CDD:293791 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.