DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and CG30116

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_725799.1 Gene:CG30116 FlyBaseID:FBgn0028496 Length:1922 Species:Drosophila melanogaster

Alignment Length:1193 Identity:214/1194 (18%)
Similarity:390/1194 (33%) Gaps:439/1194 (37%)


  Fly     6 LVVPVVLWGPTAP------------THCISSVFLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPR 58
            |:||:..|.| ||            |.||.:|:|:..:..|:.....|.:..|.:...:|..   
  Fly   873 LLVPLTGWLP-APLPSQIRTMTVSGTGCIRAVWLAPSKQHLILATSSGDVQQWHIMSNSLDH--- 933

  Fly    59 CLLVGHSAPVLCLVRASLLPENN--FLVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQIQSYHTA 121
             :..||:|.|.||:.|   |:::  .|::.||:..:..|.         |.|.:....|::.|||
  Fly   934 -IFKGHTAAVTCLLVA---PQSDSELLLTGSEDATVLVWH---------VGLRERRAHIKNAHTA 985

  Fly   122 ----------------NSEDVRLFCIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMR 170
                            :|||         |.|.:.|..|.::.:.::....|  :|.|.|.... 
  Fly   986 PITGVAAGANNTLIISSSED---------ASIAITDLASGKLRHRITHHRGP--VSGIVVAGAC- 1038

  Fly   171 RKDDVVLAITTTGTVKVWTLTGNENKHAEPIYENESKEIRCLNAITMNCC------AQNQRTVLL 229
               ||:::.....|:.||.|                .....||.:.|...      :.|...:|.
  Fly  1039 ---DVLISGGLDRTICVWDL----------------DNFTLLNTMQMTSAVLRIDISWNSVFLLA 1084

  Fly   230 VCTKYWQIYDAGDFTVLCSVIAPARERWQ-------------GGDFITSDRVMLWTDEGKGYLYK 281
            :|.         |..:....:|..:|...             |.|   |.|.::..|:.:..:|.
  Fly  1085 LCE---------DNALYVRTLATGKELHTLKGHKSKIRSISIGKD---SQRCVVGCDDTRALIYD 1137

  Fly   282 LPANCIPDNKEFHSKSVVRDAPYLYYVLQHAGDKVLSCPPAMKLLQGAGGQHN-----LLRGDSE 341
            :                            |||..|.|.||....:.......|     .:.|:..
  Fly  1138 M----------------------------HAGKLVRSLPPNPGPVTAVHAMDNDDFLVTVGGNKI 1174

  Fly   342 GYISVWNVPEVPLDNISILQAKQMP--PRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITESPV 404
            .:.|..|      :.:.:....:.|  .|.||.|.......:.::   ||:...| |||.:    
  Fly  1175 TFYSFRN------EELYVNPYSRHPRRKRSLKRHAQAQRSPSTTL---PPITCFD-LSRDS---- 1225

  Fly   405 KLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQ-ILYGHRGRVNCL- 467
                     ||..:..||           ...:|::         :.|.:| .|.||...|:|| 
  Fly  1226 ---------QQMAIASGR-----------HVHLMRI---------NTPEYQCTLEGHTAGVSCLK 1261

  Fly   468 LCPSMIHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESCSPRILKCICS 532
            ..|:       ...|.:|..|..|.:|:|..|.:.:.|..|...:.:::|        ::..:..
  Fly  1262 FAPN-------GEFLATGSEDRLVHIWNLALGEICNSFKGHTAPVVKVVV--------LMDSLRV 1311

  Fly   533 VASDH-SVTLVSLQERKCVTLASRHLFPVVTIKWRPLD-----DFLIVGCSDGSVYVWQM----- 586
            :::|. |:.||.:..       |.:|...:...::.|.     .|.:....|.::.:|.:     
  Fly  1312 ISTDRDSMLLVWMAH-------SGNLLQTIQGPYKSLSVTNNMRFAVSTNGDNTLKIWSLTQEDE 1369

  Fly   587 --ETGHLDRVLHGMLAEEVLSACDEQAEDGGSGGGGGSNGASASEMGMANPAVHFFRGLKSRNMN 649
              ...|.|.:           .|.|.:.|                      :||...|  ||:|:
  Fly  1370 KYSVSHSDEI-----------TCFEISAD----------------------SVHIISG--SRDMS 1399

  Fly   650 -AIRHATQRGITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLRTNPKDAESHILFFDIEGLIFELH 713
             .:..||...::|:  |.||:.......:...:...|:.|.:      :.:::.:|:        
  Fly  1400 LKVWQATGGKLSQV--LVGHSDAVTCVAVSVTNKTQVLSGSK------DMNLILWDL-------- 1448

  Fly   714 SEEYAQMTPATLESLGVHLQNPKDGKSMHLDASKKIGDFFNKVKNKAVDVEKILKDKDKHGLVQK 778
                  :|...:.:|..|| .|..|..:..|.|.                           .|..
  Fly  1449 ------LTGEEVHTLAGHL-GPVIGVKVSADGST---------------------------AVSG 1479

  Fly   779 FKEKTEIV-EKKVQAKVESLQKAVEPHEEQQDLKSKIASKMEVTHV---MEVAQLLLSLLHSWGL 839
            ..:||.|| |.|....:.|||..|                 ..||.   :||:::|:.|:.|:.|
  Fly  1480 SDDKTLIVWETKRGLALTSLQMHV-----------------PFTHFDISLEVSRVLVQLVDSYNL 1527

  Fly   840 DPHLDKMCETRLGLLRPIV-----PISYGVLSKAGYMSLLLPTWQN-----NYAIPPGIQLPSSS 894
                            |::     |..|          :.|||:..     ....|.|   |...
  Fly  1528 ----------------PVICLHNTPAQY----------VKLPTYSGPSKDVEDLRPQG---PKRQ 1563

  Fly   895 KKRPLPEELQRLEHLTAVFTSRLHWELSTTLTTNHILALVAMSNT------LLSMSAASFLPDSE 953
            .||.|.:|:. |:..|        |:..    ..|:.:.|.|:..      ..|:||:.      
  Fly  1564 MKRLLKKEVS-LDTYT--------WQKK----YGHLTSSVMMAQVDERLKRRFSVSASM------ 1609

  Fly   954 KHKKLQRLAQ-RTDSTLSN--EEEREELMAHHISQIKHAWSLLA----------THHCFLLPDKI 1005
              :::.::|: :|.::.:|  .|:.....:.|..|::..|:..:          :....|:.|::
  Fly  1610 --EEISKIAETKTGASQANLGPEQAALAQSQHFDQLEALWNKRSPPRRRHNAGLSRQTSLVEDRL 1672

  Fly  1006 EALEPKKFKRPQVEMMVKRWQ--HHCIEIREAAQQILLGELTRMGKKGRKQLVESW--------- 1059
            |:.:..:::..:..|:...:.  ||               |.|:  .|.:.|.::|         
  Fly  1673 ESSDDDEYQDERAGMLSASYDNIHH---------------LARL--PGLRSLHDAWKTNSLRVPS 1720

  Fly  1060 -AQYLPLYTHTEPIVGAQQQLAL 1081
             :.....|..|.|...:|...:|
  Fly  1721 RSARTKFYVSTPPPQNSQNSSSL 1743

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 48/223 (22%)
WD40 repeat 20..63 CDD:293791 8/43 (19%)
WD40 <22..202 CDD:295369 42/198 (21%)
WD40 repeat 68..107 CDD:293791 10/41 (24%)
WD40 repeat 118..152 CDD:293791 10/50 (20%)
WD40 repeat 160..204 CDD:293791 9/44 (20%)
WD40 repeat 212..251 CDD:293791 7/45 (16%)
WD40 repeat 406..459 CDD:293791 8/54 (15%)
WD40 <449..>607 CDD:225201 31/173 (18%)
WD40 453..>597 CDD:295369 30/159 (19%)
WD40 repeat 513..555 CDD:293791 6/43 (14%)
WD40 repeat 560..596 CDD:293791 6/48 (13%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
CG30116NP_725799.1 AAA_16 359..505 CDD:289934
WD40 repeat 901..937 CDD:293791 6/40 (15%)
WD40 933..1282 CDD:238121 91/486 (19%)
WD40 repeat 942..982 CDD:293791 12/52 (23%)
WD40 repeat 988..1024 CDD:293791 7/45 (16%)
WD40 1022..1484 CDD:225201 111/674 (16%)
WD40 repeat 1029..1064 CDD:293791 11/55 (20%)
WD40 repeat 1071..1106 CDD:293791 6/44 (14%)
WD40 repeat 1112..1147 CDD:293791 11/66 (17%)
WD40 repeat 1216..1252 CDD:293791 12/70 (17%)
WD40 1248..1502 CDD:238121 65/361 (18%)
WD40 repeat 1258..1294 CDD:293791 11/43 (26%)
WD40 repeat 1299..1335 CDD:293791 7/51 (14%)
WD40 repeat 1340..1374 CDD:293791 4/34 (12%)
WD40 repeat 1379..1415 CDD:293791 13/73 (18%)
WD40 repeat 1421..1458 CDD:293791 5/57 (9%)
WD40 repeat 1464..1488 CDD:293791 8/51 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.