DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and CG10132

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001286085.1 Gene:CG10132 FlyBaseID:FBgn0032798 Length:1361 Species:Drosophila melanogaster

Alignment Length:1462 Identity:249/1463 (17%)
Similarity:416/1463 (28%) Gaps:637/1463 (44%)


  Fly   356 NISILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITESPVKLTSSIYLPQQSRLVI 420
            |:|:||.|                       |||       .|..|...|:.  :|:        
  Fly   116 NLSVLQGK-----------------------PPP-------GRKIERDKKIV--VYI-------- 140

  Fly   421 GREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGHRGRVNCLLCPSMIHSRYE--KSHLL 483
                                   :..|.:::..|:               .::||.|:  ||...
  Fly   141 -----------------------LADNSTEYKKHK---------------RVVHSLYKHFKSKCQ 167

  Fly   484 SGGIDFAVCLWDLY---------SGSLLHRF--CVHAGEITQLLVPPESCSPRILKCICSVASDH 537
            |.|.||.:.  |::         :|:....|  ...|...||..:..:........|:|.: :.|
  Fly   168 SRGFDFIIA--DVHDSEPETEPGNGNARKDFSRLQEAKRWTQTPLEAQGGHEEAANCLCEI-TRH 229

  Fly   538 SVTLVSLQERKCVTLASRHLFPVVTI----------------------------------KWRPL 568
            |              |..::.||:.:                                  ||..:
  Fly   230 S--------------AGAYMIPVLFLGATLGTPMLPLTIESQDFTSVLGTASEEERLLLEKWYTI 280

  Fly   569 DDFLIVGCSDGSVYVWQME------TGHLDRVLHGML-------AEEVLSACDEQAEDG------ 614
            |:.....|.  .::..|::      .|.|:.:|..:|       .:..|:...||..:.      
  Fly   281 DNSYQPMCH--RLHAQQVDPYSSQVNGELNELLAVLLRLFSDDVKDSYLTTVVEQEINNTVLMSQ 343

  Fly   615 -----------GSGGGGGSNGASASEMGMANPAVHFFRGLKSR--NMNAIR-------------- 652
                       ||.....|..||..|:.:.....|.:.||||:  ..|.||              
  Fly   344 ELAKRCIWIQTGSQVARPSENASPLELEVQRRLSHVYSGLKSQLSEKNLIRLLPTMSILDEELSA 408

  Fly   653 ------HATQRGITQLQQ---------------------LQGH-------NQGNFD-------FL 676
                  ..|..||.:..|                     |.||       |..|||       ::
  Fly   409 VIESLLDKTLAGIFEEHQQKNSIPYNTLGVDRVLLEELRLVGHYSKLLAQNSANFDIMNDVKRYI 473

  Fly   677 MKHRSNPLVIQGLRTNPK----------------------------------------------- 694
            ....:.|||:.|.|.:.|                                               
  Fly   474 RDSTAQPLVVSGARGSGKSVLVSKIMENVHRWKPEAQLILRYANLSARSSDLTSLLGSMANQMSV 538

  Fly   695 ------------------------DAESHILFFDIEGLIFELHSEEYAQMTPATLESL------- 728
                                    |.:.......|:| :.||..:|.....|..|.|.       
  Fly   539 LETGHQCQVPHTLEGYSRVIREILDRQQRFFVLIIDG-VDELQRDELLDWLPQQLGSAKMILTVS 602

  Fly   729 -----GVHLQNPKDGKSMHLDA---------------------------SKKIGDFFNKVKNKAV 761
                 |..:...:.|.|..:.|                           |...|||:  ..|.|:
  Fly   603 ELADEGEDVDGTEAGDSFDMLAALAQLGIPQRCFLRLRQFTERQWHDILSSGGGDFY--AANGAL 665

  Fly   762 DVEKILKD-KDKHGLVQKFKEKTEIVEKKVQAKVESLQKAVEPHEEQQDLKSKIASKMEVTHVME 825
               |:..| |..||       ||....|.:. .:..|....:|..|..|:.|:|...:|.....:
  Fly   666 ---KLPDDWKTLHG-------KTPYHAKSLW-WLAWLGHVAQPISEIGDISSRILQVLESKFATD 719

  Fly   826 VAQLLLSL--LHSWGLDPHLDKMCETRLGLLRPI----VPISYGVLSK----AGYMSLLLPTWQN 880
            ..:|||.:  |..||:   .:..|   ||:.:.:    ..:::.|.||    .|.|.|.|     
  Fly   720 QVELLLLIVRLSPWGI---RESDC---LGVFQKMTQLEAQVAFKVWSKFCWLMGPMLLGL----- 773

  Fly   881 NYAIPPGIQLPSSSKKRPLPEELQRLEHLTAVFTSRLHWELSTTLTTNHILALVAMSNTLLSMSA 945
                 ..|::...|..|.                               :||..|....|:    
  Fly   774 -----KNIRIADKSFGRA-------------------------------VLARYAQKQWLV---- 798

  Fly   946 ASFLPDSEKHKKLQRLAQRTDSTLS--------NEEEREELMAHHISQI------KHAWSLLATH 996
                     |:.|:....|.||...        |.::..:|..||...:      .|...:|  .
  Fly   799 ---------HEALRDYFDRQDSEFKGSQGANTYNYQKYLKLPYHHFCAVIEDNPAPHKIDIL--F 852

  Fly   997 HCFLLPD------KIEALEPKKFKRP--QVEMMVK--------RWQHHCIEIREAAQQILLGELT 1045
            :||...|      |:.|..|:.....  |.|.:.|        .:.|.|. :::..:| .|.||:
  Fly   853 NCFYFTDLQWIANKVHATGPEHLLNDILQAEWLAKSGGENCPTAYVHICF-LKQFLEQ-YLHELS 915

  Fly  1046 RMGK----------KGR---------KQLVESWAQYLPLYTHTEPIVGAQQQLALISQPASGG-- 1089
            ..|:          |.|         .:.:.||.:|      |..:..|..::......|..|  
  Fly   916 YDGQQFYTLMKYYLKTRFREAPELKDDEKIRSWWEY------TNELEFAFLEILNADLDAENGNQ 974

  Fly  1090 AGSGSGGNGGV--GVGVSGGGGAGSGSGPGGSVPGGDAHQDE----DYEE----EEEEIIRKPSS 1144
            |......:..|  .|.|.|.....:...||..|......:.|    |.:.    .|.:.|::|::
  Fly   975 AEQEKPSDDAVPSSVPVKGYDVLMNLPQPGCYVASMCTDRSEICIWDVKNCCRIRELQGIQQPTA 1039

  Fly  1145 LSELKRKQTTAVIL----LGVIGAEFGQ-------DISQESP-------NHRGSIS--------- 1182
            :..:...:  |.:|    :.||..:.|:       .::|:.|       ||...:|         
  Fly  1040 MCPVGNYE--AAVLCRREIRVINLDEGKFKVTLKGVMNQKMPYFGLHDQNHLVCLSRNRMYVNLM 1102

  Fly  1183 -MATGANLTSGVAGGER-RKSSVVEGFGIANNLARLTSMALAHLLYAPPSPKLPQYTPLRRAAID 1245
             :.:|..:|:..||.:| ..|.:|.|.|              .:|......:.|  .||      
  Fly  1103 NLESGDCVTTFKAGEDRFLNSLLVSGDG--------------RILVCGDETQKP--FPL------ 1145

  Fly  1246 LLGRGFTVWEPYLDVSKVLLGLLEISCEGKAVPNLNYKLPLTPQADACRTARHALRLIATARPAA 1310
                  .||  :|...|:|..|        .:|:.::...|:                |.....:
  Fly  1146 ------LVW--HLSQRKLLYDL--------RIPHHDFITSLS----------------AITHEGS 1178

  Fly  1311 FITTMAREVARYNTMQQNAQSINTPLTQSVLHKAKGEILQCVEMLIDKMQSEIAGLLVEVMDIAL 1375
            ::..:|:|             :|.|.|.:.:             ::..:||   |.|.:....|.
  Fly  1179 YVCVVAKE-------------LNEPTTPNFI-------------VVYDLQS---GTLFKKWKPAC 1214

  Fly  1376 HCVDGNELKNRGLAELCPAICKFNQISHCAQTRRIAVGANSGNLAIYELRQNKCQ-MIPAHTHPI 1439
            :.|        .||        .:|::.|     :..|.....:.|::|....|: .:..|..|:
  Fly  1215 NTV--------SLA--------ISQVNAC-----VIAGLEDAKILIWDLVTGNCKSTLIGHNAPV 1258

  Fly  1440 TSLAFSPDGKYLVSYSCAENR---LSFWQTST 1468
            |.|...|.||.|:||. .|.|   :..|:.::
  Fly  1259 TFLKLDPLGKVLLSYD-KEGRDSAVRMWELNS 1289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791 3/53 (6%)
WD40 <449..>607 CDD:225201 33/218 (15%)
WD40 453..>597 CDD:295369 31/197 (16%)
WD40 repeat 513..555 CDD:293791 7/42 (17%)
WD40 repeat 560..596 CDD:293791 9/76 (12%)
WD40 <1395..>1469 CDD:225201 19/79 (24%)
WD40 <1399..1495 CDD:295369 19/75 (25%)
WD40 repeat 1439..1466 CDD:293791 11/30 (37%)
CG10132NP_001286085.1 AAA_22 474..599 CDD:290137 15/126 (12%)
WD40 <1006..1304 CDD:225201 70/392 (18%)
WD40 repeat 1039..1072 CDD:293791 5/35 (14%)
WD40 repeat 1079..1114 CDD:293791 6/35 (17%)
WD40 1109..>1317 CDD:295369 53/287 (18%)
WD40 repeat 1122..1160 CDD:293791 14/76 (18%)
WD40 repeat 1167..1252 CDD:293791 21/151 (14%)
WD40 repeat 1258..1294 CDD:293791 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117964885
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.