DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and WDR7

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_056100.2 Gene:WDR7 HGNCID:13490 Length:1490 Species:Homo sapiens

Alignment Length:1599 Identity:658/1600 (41%)
Similarity:959/1600 (60%) Gaps:183/1600 (11%)


  Fly     1 MVSTNLVVPVVLWGPTAPTHCISSVFLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLVGHS 65
            |...:||:|:||||..|||||||:|.|:||..|:||||:|||||||.:. ..|:::||.||.||:
Human     1 MAGNSLVLPIVLWGRKAPTHCISAVLLTDDGATIVTGCHDGQICLWDLS-VELQINPRALLFGHT 64

  Fly    66 APVLCLVRASLLPENNFLVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQIQSYH--TANSEDVRL 128
            |.:.||.:|....:..::||:||:||||.||::||:|:|..||...||.||.|.  ..|..:.||
Human    65 ASITCLSKACASSDKQYIVSASESGEMCLWDVSDGRCIEFTKLACTHTGIQFYQFSVGNQREGRL 129

  Fly   129 FCIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRRKDDVVLAITTTGTVKVWTLTG- 192
            .|.|:|.||:|:|..||||:|.|.||:.|||||::.::|..|.::|.|:|::.||.:|||.:|. 
Human   130 LCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVALSVTGILKVWIVTSE 194

  Fly   193 -NENKHAEPIYENESKEIRCLNAITMNCCAQNQRTVLLVCTKYWQIYDAGDFTVLCSVIAPARER 256
             ::.:..|||:|.|||.|.|.|..:::.||..||::|:||:|||:::||||:::|||..:...:.
Human   195 ISDMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQT 259

  Fly   257 WQGGDFITSDRVMLWTDEGKGYLYKLPANCIPDNKEFHS---KSVVRDAPYLYYVLQHAGDK-VL 317
            |.||||::||:|::||:.|:.|:|||||:|:|.:..|.|   |:|....|.:.::|....|| :|
Human   260 WTGGDFVSSDKVIIWTENGQSYIYKLPASCLPASDSFRSDVGKAVENLIPPVQHILLDRKDKELL 324

  Fly   318 SCPPAMKLLQGAGGQ-HNLL-RGDSEGYISVWNVPEVPLDNISILQAKQMPPRPLKPHVCTSLVE 380
            .|||..:...|.... |.|| :|||.|.:::|        |||....||.....|......||.|
Human   325 ICPPVTRFFYGCREYFHKLLIQGDSSGRLNIW--------NISDTADKQGSEEGLAMTTSISLQE 381

  Fly   381 AWSIMDPPPVGILDQLSRITES--PVKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQLLVG 443
            |:..::|.|.||:||||.|..|  |:|:|:|:|:|...|||.|||||||||||||||.::|||.|
Human   382 AFDKLNPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGRLVCGREDGSIVIVPATQTAIVQLLQG 446

  Fly   444 IKQNFSDWPSHQILYGHRGRVNCLLCPSMIHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRFCVH 508
            .......||.|:.|.|||.:|.|||.|..:.:||::.:|:|||:||:|.:||::||.:.|.||||
Human   447 EHMLRRGWPPHRTLRGHRNKVTCLLYPHQVSARYDQRYLISGGVDFSVIIWDIFSGEMKHIFCVH 511

  Fly   509 AGEITQLLVPPESCSPRILKCICSVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLI 573
            .|||||||||||:||.|:..|||||||||||.|:||:|:||:.||||||||:..|||||.||:|:
Human   512 GGEITQLLVPPENCSARVQHCICSVASDHSVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLV 576

  Fly   574 VGCSDGSVYVWQMETGHLDRVLHGMLAEEVLSACDEQAEDGGSGGGGGSNGASASEMGMANPAVH 638
            |||||||||||||:||.|||.:.|:.|.|:|:||||              ...|:...:::|||:
Human   577 VGCSDGSVYVWQMDTGALDRCVMGITAVEILNACDE--------------AVPAAVDSLSHPAVN 627

  Fly   639 FFRGLKSRNMNAIR----HATQRGITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLRTNPKDAESH 699
            ..:.:..|::.|::    |..|...|.|...:..::||   |.|:..|.|::|.::||..|.:.|
Human   628 LKQAMTRRSLAALKNMAHHKLQTLATNLLASEASDKGN---LPKYSHNSLMVQAIKTNLTDPDIH 689

  Fly   700 ILFFDIEGLIFELHSEEYAQMTPATLESLGVHLQNPKDGKSMHLDASKKIGDFFNKVKNKAVDVE 764
            :||||:|.||.:|.:||.::...|.:....:...:....|.......|:....|.:||       
Human   690 VLFFDVEALIIQLLTEEASRPNTALISPENLQKASGSSDKGGSFLTGKRAAVLFQQVK------- 747

  Fly   765 KILKDKDKHGLVQKFKEKTEIVEKKVQAKVESLQKAVEPHEEQQDLKSKIASKMEVTHVMEVAQL 829
            :.:|:..|..|:...:|..||:.          |:..|...|.:..|||..:.:|....|:.|:|
Human   748 ETIKENIKEHLLDDEEEDEEIMR----------QRREESDPEYRSSKSKPLTLLEYNLTMDTAKL 802

  Fly   830 LLSLLHSWGLDPHLDKMCETRLGLLRPIVPISYGVLSKAGYMSLLLPTWQNNYAIPPGIQLPSSS 894
            .:|.||:|||:..||::|..|||:|:|...:|:|:||:.|:|||:||.:..     |..:|  |.
Human   803 FMSCLHAWGLNEVLDEVCLDRLGMLKPHCTVSFGLLSRGGHMSLMLPGYNQ-----PACKL--SH 860

  Fly   895 KKRPLPEELQRLEHLTAVFTSRLHWELSTTLTTNHILALVAMSNTLLSMSAASFL---------- 949
            .|..:..:|...|.:     .:..:.:|..:||.|:|::::::|||:||:.|:|:          
Human   861 GKTEVGRKLPASEGV-----GKGTYGVSRAVTTQHLLSIISLANTLMSMTNATFIGDHMKKGPTR 920

  Fly   950 ------PDSEKHK------------KLQRLA-----QRTDSTLSNEEEREELMAHHISQIKHAWS 991
                  ||..|.:            :::::|     .|:|:..|..:.......|....:...||
Human   921 PPRPSTPDLSKARGSPPTSSNIVQGQIKQVAAPVVSARSDADHSGSDPPSAPALHTCFLVNEGWS 985

  Fly   992 LLATHHCFLLPDKIEALEPKKFKRPQVEMMVKRWQHHCIEIREAAQQILLGELTRMGKKGRKQLV 1056
            .||..||.:|||   .|...||:.|.:||:.:|||..|:|:|||||.:||.||.|:.:.|||:.:
Human   986 QLAAMHCVMLPD---LLGLDKFRPPLLEMLARRWQDRCLEVREAAQALLLAELRRIEQAGRKEAI 1047

  Fly  1057 ESWAQYLPLY-THT-EPIVGAQQQLALISQPASGGAGSGSGGNGGVGVGVSGGGGAGSGSGPGGS 1119
            ::||.|||.| .|. .|.|.::....:.:.|                          ..|||...
Human  1048 DAWAPYLPQYIDHVISPGVTSEAAQTITTAP--------------------------DASGPEAK 1086

  Fly  1120 VPGGDAHQDEDYEEEEEEI----------IRKPSSLSELKRKQTTAVILLGVIGAEFGQDISQES 1174
            |      |:|:::..:::|          ::|.|:..|.:|||.||::||||||||||.:|  |.
Human  1087 V------QEEEHDLVDDDITTGCLSSVPQMKKISTSYEERRKQATAIVLLGVIGAEFGAEI--EP 1143

  Fly  1175 PNHRGSISMATGANLTSGVAGGERRKSSVVEGFGIAN-----NLARLTSMALAHLLYAPPSPKLP 1234
            |.                :....|..|.:.||||:.:     :|||.|..||..||..|||||||
Human  1144 PK----------------LLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLP 1192

  Fly  1235 QYTPLRRAAIDLLGRGFTVWEPYLDVSKVLLGLLEISCEG-KAVPNLNYKLPLTPQADACRTARH 1298
            .::.:||.||||:||||||||||:|||.||:||||:..:. |.:.|:...|||:|.||:.|:|||
Human  1193 PHSTIRRTAIDLIGRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARH 1257

  Fly  1299 ALRLIATARPAAFITTMAREVARYNTMQQNAQSINTPLTQSVLHKAKGEILQCVEMLIDKMQSEI 1363
            ||.|||||||.|||||:|:||.|:..:..|.||.....| :.|.:||||||:.:|:||:||.:::
Human  1258 ALSLIATARPPAFITTIAKEVHRHTALAANTQSQQNMHT-TTLARAKGEILRVIEILIEKMPTDV 1321

  Fly  1364 AGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRIAVGANSGNLAIYELRQNK 1428
            ..||||||||.::|::|:.:|.:||.|..||||:|..:|:..:..||||||..|::|:|::|..|
Human  1322 VDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERNHRIAVGARHGSVALYDIRTGK 1386

  Fly  1429 CQMIPAHTHPITSLAFSPDGKYLVSYSCAENRLSFWQTSTGMFG-LGQ----SQTRCTKGYSTAP 1488
            ||.|..|..|||::||:|||:||.:||..::.:||||.:|.:.| :|.    .|.||.|.|...|
Human  1387 CQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPP 1451

  Fly  1489 IPDVS--RLNPMRLAKLVWINNRTVTLMLADGSETRFNV 1525
            :...|  ..|.::||:|:|.:||.|.||..||.|.||.|
Human  1452 VQPASPGSHNALKLARLIWTSNRNVILMAHDGKEHRFMV 1490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 97/197 (49%)
WD40 repeat 20..63 CDD:293791 25/43 (58%)
WD40 <22..202 CDD:295369 87/184 (47%)
WD40 repeat 68..107 CDD:293791 17/39 (44%)
WD40 repeat 118..152 CDD:293791 17/36 (47%)
WD40 repeat 160..204 CDD:293791 17/46 (37%)
WD40 repeat 212..251 CDD:293791 18/39 (46%)
WD40 repeat 406..459 CDD:293791 30/53 (57%)
WD40 <449..>607 CDD:225201 100/158 (63%)
WD40 453..>597 CDD:295369 93/144 (65%)
WD40 repeat 513..555 CDD:293791 31/42 (74%)
WD40 repeat 560..596 CDD:293791 26/36 (72%)
WD40 <1395..>1469 CDD:225201 36/74 (49%)
WD40 <1399..1495 CDD:295369 42/103 (41%)
WD40 repeat 1439..1466 CDD:293791 15/27 (56%)
WDR7NP_056100.2 WD 1 17..56 24/40 (60%)
WD40 <19..195 CDD:225201 87/177 (49%)
WD40 <19..102 CDD:295369 45/84 (54%)
WD40 repeat 22..62 CDD:293791 23/41 (56%)
WD 2 62..104 20/42 (48%)
WD40 repeat 68..109 CDD:293791 19/41 (46%)
WD40 repeat 114..153 CDD:293791 19/39 (49%)
WD 3 156..199 16/43 (37%)
WD40 repeat 162..208 CDD:293791 16/46 (35%)
WD 4 324..366 18/50 (36%)
WD40 341..>592 CDD:225201 147/259 (57%)
WD 5 404..443 25/39 (64%)
WD40 408..>598 CDD:295369 122/190 (64%)
WD40 repeat 409..461 CDD:293791 30/52 (58%)
WD 6 462..507 22/45 (49%)
WD40 repeat 516..558 CDD:293791 31/42 (74%)
WD 7 558..597 31/39 (79%)
WD40 repeat 563..589 CDD:293791 20/26 (77%)
WD 8 1351..1390 19/39 (49%)
WD40 <1357..1426 CDD:295369 32/69 (46%)
WD40 repeat 1357..1391 CDD:293791 15/34 (44%)
WD40 <1359..>1427 CDD:225201 33/68 (49%)
WD 9 1392..1432 19/40 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C341258765
eggNOG 1 0.900 E1_KOG4155
Hieranoid 1 1.000
Homologene 1 1.000 H11408
Inparanoid 1 1.050 1161 1.000 Inparanoid score I204
Isobase 1 0.950 1 Normalized mean entropy S4302
OMA 1 1.010
OrthoDB 1 1.010 D331603at33208
OrthoFinder 1 1.000 FOG0004780
OrthoInspector 1 1.000 T1075543
orthoMCL 1 0.900 OOG5_132137
Panther 1 1.100 O PTHR44099
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4239
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.