DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and Apaf1

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001036023.1 Gene:Apaf1 MGIID:1306796 Length:1249 Species:Mus musculus

Alignment Length:593 Identity:113/594 (19%)
Similarity:185/594 (31%) Gaps:224/594 (38%)


  Fly    12 LWGPT-APTHCISSVFLSDDQFTLVTGC-YDGQICLWQVEPTTLKMSPRCLLVGHSAPVLCLVRA 74
            ::|.| :..||   .|..||:  |:..| .||.:.||.|.....:.|                  
Mouse   739 MFGHTNSVNHC---RFSPDDE--LLASCSADGTLRLWDVRSANERKS------------------ 780

  Fly    75 SLLPENNFLVSSSENGE-------MCTWDLTDGKCMEAVK----LPQVHTQ--IQSYHTANSEDV 126
              :....|.:||.:..|       .|:|.....|.:.|.|    |..:||.  :...||.:...:
Mouse   781 --INVKRFFLSSEDPPEDVEVIVKCCSWSADGDKIIVAAKNKVLLFDIHTSGLLAEIHTGHHSTI 843

  Fly   127 RLFCIGYYAEIMV--MDPFSLEVIYVLSSKVKP-------DWISAIHVLRP-----MRRKDDVVL 177
            :......|..:.|  :..:.:| ::.:.|::|.       .|:..: :..|     :...||   
Mouse   844 QYCDFSPYDHLAVIALSQYCVE-LWNIDSRLKVADCRGHLSWVHGV-MFSPDGSSFLTASDD--- 903

  Fly   178 AITTTGTVKVWTLTGNENKHAEPIYENESKEIRCLNAI---------------TMNCCAQNQRTV 227
                 .|::||                |:|:: |.|:.               ||.....|.|.:
Mouse   904 -----QTIRVW----------------ETKKV-CKNSAIVLKQEIDVVFQENETMVLAVDNIRGL 946

  Fly   228 LLVCTKYWQIYDAGDFTVLCSVIAPARERWQGGDFITSDRVMLWTDEGKGYLYKLPANCIPDNKE 292
            .|:..|..||....:..|.|..::|..|....||           ::|...:.:||.|.:..:..
Mouse   947 QLIAGKTGQIDYLPEAQVSCCCLSPHLEYVAFGD-----------EDGAIKIIELPNNRVFSSGV 1000

  Fly   293 FHSKSVVRDAPYLYYVLQHAGDKVLSCPPAMKLLQGAGGQHNLLRGDSEGYISVWNVPEVPLDNI 357
            .|.|:|           :|              :|.......|:....:..|.|||   ....:.
Mouse  1001 GHKKAV-----------RH--------------IQFTADGKTLISSSEDSVIQVWN---WQTGDY 1037

  Fly   358 SILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITESPVKLTSSIYLPQQSRLVIGR 422
            ..|||.|                                        :......|.|.|||:...
Mouse  1038 VFLQAHQ----------------------------------------ETVKDFRLLQDSRLLSWS 1062

  Fly   423 EDGSI----VIVPATQ--------TVMMQLLVGIKQNFSD---------W------PSHQILYGH 460
            .||::    ||....:        ||:...:......||.         |      |.|: |.||
Mouse  1063 FDGTVKVWNVITGRIERDFTCHQGTVLSCAISSDATKFSSTSADKTAKIWSFDLLSPLHE-LKGH 1126

  Fly   461 RGRVNCLLCPSMIHSRYEKSHLL--SGGIDFAVCLWDLYSGSLLHRFC----------VHAGEIT 513
            .|.|.|        |.:....:|  :|..:..:.:|::..|.|||. |          .|.|.:|
Mouse  1127 NGCVRC--------SAFSLDGILLATGDDNGEIRIWNVSDGQLLHS-CAPISVEEGTATHGGWVT 1182

  Fly   514 QLLVPPES 521
            .:...|:|
Mouse  1183 DVCFSPDS 1190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 41/221 (19%)
WD40 repeat 20..63 CDD:293791 13/44 (30%)
WD40 <22..202 CDD:295369 37/208 (18%)
WD40 repeat 68..107 CDD:293791 8/46 (17%)
WD40 repeat 118..152 CDD:293791 5/36 (14%)
WD40 repeat 160..204 CDD:293791 6/49 (12%)
WD40 repeat 212..251 CDD:293791 11/54 (20%)
WD40 repeat 406..459 CDD:293791 17/80 (21%)
WD40 <449..>607 CDD:225201 24/101 (24%)
WD40 453..>597 CDD:295369 21/82 (26%)
WD40 repeat 513..555 CDD:293791 3/10 (30%)
WD40 repeat 560..596 CDD:293791
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
Apaf1NP_001036023.1 CARD_APAF1 7..92 CDD:260034
NB-ARC 129..414 CDD:279299
WD40 <598..688 CDD:225201
WD40 607..910 CDD:238121 41/222 (18%)
WD 1-1. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 613..652
WD40 repeat 623..655 CDD:293791
WD40 653..1038 CDD:225201 73/390 (19%)
WD 1-2. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 655..694
WD40 repeat 661..697 CDD:293791
WD 1-3. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 697..738
WD40 repeat 702..740 CDD:293791 0/1 (0%)
WD 1-4. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 741..780 14/44 (32%)
WD40 repeat 747..789 CDD:293791 14/67 (21%)
WD 1-5. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 796..837 9/41 (22%)
WD40 repeat 801..837 CDD:293791 9/36 (25%)
WD 1-6. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 838..877 5/40 (13%)
WD40 repeat 843..882 CDD:293791 5/40 (13%)
WD 1-7. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 880..910 7/55 (13%)
WD40 repeat 885..909 CDD:293791 5/33 (15%)
Interpropeller linker 910..921 4/12 (33%)
WD 2-1. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 922..958 8/36 (22%)
WD 2-2. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 959..998 10/50 (20%)
WD40 961..1235 CDD:238121 60/320 (19%)
WD40 repeat 964..999 CDD:293791 10/46 (22%)
WD 2-3. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 1001..1040 10/67 (15%)
WD40 repeat 1006..1030 CDD:293791 6/49 (12%)
WD40 1042..>1235 CDD:225201 38/200 (19%)
WD 2-4. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 1042..1080 11/78 (14%)
WD40 repeat 1048..1082 CDD:293791 9/34 (26%)
WD 2-5. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 1083..1122 7/39 (18%)
WD40 repeat 1089..1124 CDD:293791 6/36 (17%)
WD 2-6. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 1125..1164 13/47 (28%)
WD40 repeat 1130..1174 CDD:293791 11/53 (21%)
WD 2-7. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 1176..1213 5/16 (31%)
WD40 repeat 1181..1203 CDD:293791 3/11 (27%)
WD 2-8. {ECO:0000255|PROSITE-ProRule:PRU00221, ECO:0000269|PubMed:21827944} 1214..1249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.