DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and tep1

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_012825586.1 Gene:tep1 XenbaseID:XB-GENE-495387 Length:2665 Species:Xenopus tropicalis

Alignment Length:648 Identity:121/649 (19%)
Similarity:205/649 (32%) Gaps:223/649 (34%)


  Fly    26 FLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLVGHSAPVLCLVRASLLPENNFLVSSSENG 90
            |:|||  .|..|.|||.:.:|       |:|..|.:....|....:....:.|:...|::.|.:.
 Frog  1848 FISDD--LLCVGSYDGILEIW-------KISDGCRMHRAEAHRRQITGCCVSPDQRQLITCSLDY 1903

  Fly    91 EMCTWDLTDGKCMEAVKLPQVHTQIQSYHTANSEDVRLFCIGYYAEIMVMDPFSLEVIYVLSSKV 155
            ::..|:.:.|..:.::..|                ..|.|..::....|:...|           
 Frog  1904 QLKLWETSRGSLLGSISFP----------------YPLACTTFHPRGHVVAVGS----------- 1941

  Fly   156 KPDWISAIHVLRPMRRKDDVVLAITTTGTVKVWTLTGNENKHAEPIYENESKEIRCLNAITMNCC 220
               |...|.|||                 ::.|..|                        .:.|.
 Frog  1942 ---WDGKITVLR-----------------LENWEKT------------------------AVLCG 1962

  Fly   221 AQNQRTVLLVCTKYWQIYDAGD----------------------FTVLCSVIAPARERWQGGDFI 263
            :.:.|||.......|.|..:.|                      .|:.||.:...:....||:  
 Frog  1963 SSSVRTVSFSQDGKWLISGSLDGWVSLWAWEAQVQLSHFKAHSGSTLTCSFLQQGKYLLTGGE-- 2025

  Fly   264 TSDRVMLWTDEGKGYLYKLPANCIPDNKEFHSKSVVRDAPYLYYVLQHAGDKVLSCPPAMKLLQG 328
             ..:|.:|:    |.|.:|....   :.|..:.|.:.                |:..|:.:||  
 Frog  2026 -DSKVQVWS----GGLGRLLGRV---DGEIKNSSAIS----------------LAVSPSRQLL-- 2064

  Fly   329 AGGQHNLLRGDSEGYISVWN------VPEVPLDNISILQAKQMPPRPLKPHVCTSLVEAWSIMDP 387
            |.|.|.       |.:||::      |.:..:::::||....:....|......|||..|.|   
 Frog  2065 AVGYHT-------GTVSVYSVDLGDLVAQTSIEDVTILCVAWLSEEVLVTGTSDSLVRVWKI--- 2119

  Fly   388 PPVGILDQLSRITESPVKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQL--LVGIKQNFSD 450
                          |..:.|..:.|.:..|.|......|.::..|:..|.:.|  |..:..:.|.
 Frog  2120 --------------SSGQFTCQLMLKEHQRFVQALAVSSKLLASASGDVSVCLWSLNSLLNSVSP 2170

  Fly   451 WPSHQILYGHRGRVNC------------------LLC-------PSMIH-------------SRY 477
            .....:|.||...|.|                  :||       ||::|             |..
 Frog  2171 PSPASVLQGHSAAVTCCSFSRNGKLLATGSQDRSVLCWDVSLIPPSVVHALPSCHRDWVTACSWT 2235

  Fly   478 EKSHLLSGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESCSPRILKCICSVASDHSVTLV 542
            :...|:|...|.:|||||:.....|..|..|...::..:...|.        :.:.:.|..:.:.
 Frog  2236 DADMLVSCSGDGSVCLWDIQREERLLDFAGHQSAVSSAICMGER--------VITTSRDGCLKVW 2292

  Fly   543 SLQERKCVTL-ASRHLFPVVTIKWRPLDD------FLIVGCSDGSVYVW------QMET--GH 590
            :|...:...: |.:.........|.|:|.      .:.|.||||||..|      |::|  ||
 Frog  2293 NLAGLEVANISAHQEQINQSAAFWMPVDRQDDANLVVYVACSDGSVLKWSPLQMDQIQTLYGH 2355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 31/178 (17%)
WD40 repeat 20..63 CDD:293791 13/37 (35%)
WD40 <22..202 CDD:295369 31/176 (18%)
WD40 repeat 68..107 CDD:293791 5/39 (13%)
WD40 repeat 118..152 CDD:293791 4/34 (12%)
WD40 repeat 160..204 CDD:293791 6/44 (14%)
WD40 repeat 212..251 CDD:293791 10/61 (16%)
WD40 repeat 406..459 CDD:293791 11/55 (20%)
WD40 <449..>607 CDD:225201 42/196 (21%)
WD40 453..>597 CDD:295369 41/192 (21%)
WD40 repeat 513..555 CDD:293791 4/43 (9%)
WD40 repeat 560..596 CDD:293791 15/46 (33%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
tep1XP_012825586.1 TROVE 309..634 CDD:283406
DUF4062 1016..1116 CDD:290011
P-loop_NTPase 1274..1442 CDD:304359
WD40 <1801..1966 CDD:225201 32/198 (16%)
WD40 1803..2077 CDD:238121 60/344 (17%)
WD40 repeat 1803..1838 CDD:293791
WD40 repeat 1843..1879 CDD:293791 13/40 (33%)
WD40 repeat 1885..1917 CDD:293791 5/32 (16%)
WD40 repeat 1922..1961 CDD:293791 12/110 (11%)
WD40 1963..2436 CDD:225201 89/454 (20%)
WD40 1963..2293 CDD:238121 72/390 (18%)
WD40 repeat 1967..2002 CDD:293791 6/35 (17%)
WD40 repeat 2009..2044 CDD:293791 9/45 (20%)
WD40 repeat 2054..2089 CDD:293791 11/60 (18%)
WD40 repeat 2095..2132 CDD:293791 10/54 (19%)
WD40 repeat 2137..2178 CDD:293791 8/41 (20%)
WD40 2176..2444 CDD:238121 41/189 (22%)
WD40 repeat 2185..2222 CDD:293791 6/37 (16%)
WD40 repeat 2229..2264 CDD:293791 11/35 (31%)
WD40 repeat 2270..2304 CDD:293791 3/42 (7%)
WD40 repeat 2311..2341 CDD:293791 10/30 (33%)
WD40 2349..>2634 CDD:295369 3/8 (38%)
WD40 repeat 2402..2441 CDD:293791
WD40 repeat 2442..2465 CDD:293791
WD40 repeat 2474..2529 CDD:293791
WD40 repeat 2537..2576 CDD:293791
WD40 repeat 2591..2625 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.