DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbcn-3B and apaf1

Sequence 1:NP_001284797.1 Gene:Rbcn-3B FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_012815297.1 Gene:apaf1 XenbaseID:XB-GENE-988968 Length:1248 Species:Xenopus tropicalis

Alignment Length:642 Identity:110/643 (17%)
Similarity:201/643 (31%) Gaps:212/643 (33%)


  Fly    64 HSAPVLCLVRASLLPENNFLVSSSENGEMCTWDLTDGKCM-------EAVKLPQVHTQIQSYHTA 121
            |...|||   .:...:...|.:.|.:.::..|:...||.:       |.|...|....:.:...|
 Frog   656 HDDEVLC---CAFSADEKLLATCSADRKVKIWNAKTGKPLRVYEEHIEQVNCCQFTNSLSAPLLA 717

  Fly   122 -----------NSEDVRLFC----IGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRR 171
                       |||  :.:|    ||:           :|.:|  ..:..||             
 Frog   718 TCSNDCLIKLWNSE--KNYCHNTLIGH-----------IESVY--HCRYSPD------------- 754

  Fly   172 KDDVVLAITTTGTVKVWTL-TGNENKHAE--PIYENESKEIRCLNAITMNCCA--QNQRTVLLVC 231
             |..:.:.:..|::|:|.: :.||.|..|  .::|||.:   ....:.:.|||  .:...:::..
 Frog   755 -DRYLASSSMDGSLKIWDVESANEEKSIEVAKLFENEDE---AQPEVLLKCCAWSNDGSRIMVTA 815

  Fly   232 TKYWQIYDAGDFTVLCSVIAPARERWQ--GGDFITSDR----------VMLWTDEGKGYLYKLPA 284
            ..:..||||    ..|::::..:...|  ..||.|:::          |.||..:....:....|
 Frog   816 RNFLCIYDA----ERCNLLSQLKACHQILYCDFCTTNQIAALALSHYVVQLWDIDSSTKIADFNA 876

  Fly   285 -----NCIPDNKEFHSKSVVRDAPYLYYVLQHAGDKVLSCPPAMKLLQGAGGQHNLLRGDSEGYI 344
                 :|:    :|..||                                   .:.|....:..:
 Frog   877 HLSWVHCV----KFSPKS-----------------------------------SSFLTSSDDQTV 902

  Fly   345 SVW---NVPEVPLDNIS-----ILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITE 401
            .:|   ||.:....|:.     ....::..........|..|:...:       |  :.||:|..
 Frog   903 KLWETSNVSKPAATNLKREFDVTFSGERTLVLATSKDDCILLINGMT-------G--ETLSQIRA 958

  Fly   402 SPVKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILY---GHRGR 463
            ....:|............||..||.:.|:                   |....:||:   |||..
 Frog   959 QDNCVTCCCLSTDYQLAAIGHRDGKVKIL-------------------DLSGGEILHKLDGHRDT 1004

  Fly   464 V------------------------------NCLLC----PSMIHSRYEKSHLLSGGIDFAVCLW 494
            |                              |..||    |.......::|.:.|...|..|.:|
 Frog  1005 VQHCQFTADGKLLVSSSDDCTVRVWNLVSGKNLELCGHKEPVKFFKILQESKVFSWSFDGTVKVW 1069

  Fly   495 DLYSGSLLHRFCVHAGEITQLLVPPESCSPRILKCICSVASDHSVTLVSLQERKCVTLASRHLFP 559
            :|.:|.|:..|..|:..:....:.|:|..      ..|.::|.|..:.:|.....:...::|...
 Frog  1070 NLLTGQLIKEFICHSATVLACDISPDSTK------FSSASTDKSAKIWNLDNCALLHELNKHQSC 1128

  Fly   560 VVTIKWRPLDDFLIVGCSDGSVYVWQMETGHLDRVLHGMLAEEVLSACDEQAEDGGS 616
            |...::...:.:|..|...|.:.:|.::.|.|.|           ..||....:..|
 Frog  1129 VRCCRFSWDNQYLATGDDSGKIMIWSVQNGELLR-----------ECCDVSVNNENS 1174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 32/165 (19%)
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369 31/163 (19%)
WD40 repeat 68..107 CDD:293791 10/46 (22%)
WD40 repeat 118..152 CDD:293791 9/49 (18%)
WD40 repeat 160..204 CDD:293791 9/47 (19%)
WD40 repeat 212..251 CDD:293791 8/41 (20%)
WD40 repeat 406..459 CDD:293791 9/56 (16%)
WD40 <449..>607 CDD:225201 36/195 (18%)
WD40 453..>597 CDD:295369 35/181 (19%)
WD40 repeat 513..555 CDD:293791 6/42 (14%)
WD40 repeat 560..596 CDD:293791 8/36 (22%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
apaf1XP_012815297.1 DD 7..92 CDD:301326
NB-ARC 131..409 CDD:279299
WD40 <599..766 CDD:225201 25/142 (18%)
WD40 610..906 CDD:238121 56/328 (17%)
WD40 repeat 619..655 CDD:293791
WD40 repeat 660..697 CDD:293791 8/40 (20%)
WD40 repeat 703..741 CDD:293791 7/40 (18%)
WD40 706..1201 CDD:225201 99/590 (17%)
WD40 repeat 746..788 CDD:293791 11/58 (19%)
WD40 repeat 800..875 CDD:293791 15/79 (19%)
WD40 871..1203 CDD:238121 61/389 (16%)
WD40 repeat 881..916 CDD:293791 8/74 (11%)
WD40 repeat 921..957 CDD:293791 6/45 (13%)
WD40 repeat 963..1000 CDD:293791 9/56 (16%)
WD40 repeat 1006..1041 CDD:293791 3/35 (9%)
WD40 repeat 1046..1080 CDD:293791 8/34 (24%)
WD40 repeat 1088..1123 CDD:293791 6/41 (15%)
WD40 repeat 1129..1170 CDD:293791 10/52 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.