DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and FES1

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_009659.3 Gene:FES1 / 852397 SGDID:S000000305 Length:290 Species:Saccharomyces cerevisiae


Alignment Length:88 Identity:18/88 - (20%)
Similarity:37/88 - (42%) Gaps:18/88 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YVTPIKAGRVIVEIAGK-------CEFVEVKQFLQQVANQLPFQATVVSQEM-LDEQRV------ 201
            |::.:|....|:.:..|       .|.:..:..|..:...|.|.:.::|..: .:||.:      
Yeast   203 YLSSVKIDENIISVLRKDGVIESTIECLSDESNLNIIDRVLSFLSHLISSGIKFNEQELHKLNEG 267

  Fly   202 ---AEEEQTRQNENPF-TMKYVI 220
               .|..:.|.||:.: .:|||:
Yeast   268 YKHIEPLKDRLNEDDYLAVKYVL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 6/39 (15%)
FES1NP_009659.3 Fes1 1..82 CDD:400776
SPK 125..224 CDD:416338 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.