powered by:
Protein Alignment mRpL16 and RPL10
DIOPT Version :9
| Sequence 1: | NP_001259148.1 |
Gene: | mRpL16 / 31150 |
FlyBaseID: | FBgn0023519 |
Length: | 243 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_013176.1 |
Gene: | RPL10 / 850764 |
SGDID: | S000004065 |
Length: | 221 |
Species: | Saccharomyces cerevisiae |
| Alignment Length: | 39 |
Identity: | 8/39 - (20%) |
| Similarity: | 17/39 - (43%) |
Gaps: | 13/39 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 YQNVEQPERPK-------------LRVIERQPQLPPNIR 62
:.|:::||..| ::.:.::..|..|||
Yeast 173 FTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIR 211
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| mRpL16 | NP_001259148.1 |
Ribosomal_L16 |
64..184 |
CDD:278672 |
|
| RPL10 | NP_013176.1 |
PTZ00173 |
1..206 |
CDD:185498 |
4/32 (13%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0197 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.