DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and SAC52

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_563945.2 Gene:SAC52 / 837993 AraportID:AT1G14320 Length:220 Species:Arabidopsis thaliana


Alignment Length:165 Identity:32/165 - (19%)
Similarity:51/165 - (30%) Gaps:56/165 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YQNVEQPERPKLRVIERQPQLPPNIRPPKM-QKRLRYMRGPEMVHNTLLHKQ------------- 87
            |:.::....||.|.....|.  |.||...: .||......|..||.....|:             
plant     9 YRQIKGKPYPKSRYCRGVPD--PKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIA 71

  Fly    88 ---YAIVATGGG----RLRWGHYEMMRLTIGRKMNVNTMFATWRVPAPWQPITKKGQGQRMGGGK 145
               |.:.:.|..    |:|...:.::|        :|.|            ::..|..:...|.:
plant    72 CNKYMVKSAGKDAFHLRIRVHPFHVLR--------INKM------------LSCAGADRLQTGMR 116

  Fly   146 GAIDHYVTPIKAGRVIVEIAGKCEFVEVKQFLQQV 180
            ||.         |:.:    |.|..|.:.|.|..|
plant   117 GAF---------GKAL----GTCARVAIGQVLLSV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 24/138 (17%)
SAC52NP_563945.2 PTZ00173 1..211 CDD:185498 32/165 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.