DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and Rpl10l

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_003750221.1 Gene:Rpl10l / 299106 RGDID:1305913 Length:214 Species:Rattus norvegicus


Alignment Length:111 Identity:25/111 - (22%)
Similarity:45/111 - (40%) Gaps:21/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 MGGGKGAIDHYVTPIKAGRVIVEIAGKCEFVE-VKQFLQQVANQLPFQATVVSQEMLDEQRVAEE 204
            |.|..|.....|..:..|:||:.|..|.:..| |.:.|::...:.|           ..|::...
  Rat   115 MRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFP-----------GRQKIHIS 168

  Fly   205 EQ---TRQNENPFTMKYVIQNNL-SGCH-RWL---SPVDHKWFGKH 242
            ::   |:.|.:.|..|...:..: .||. :::   .|:| ||...|
  Rat   169 KKWGFTKFNADEFEDKVAAKRLIPDGCGVKYIPERGPLD-KWRALH 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 12/43 (28%)
Rpl10lXP_003750221.1 PTZ00173 1..209 CDD:185498 22/105 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.