DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and SPBC3B9.01

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_596658.1 Gene:SPBC3B9.01 / 2540288 PomBaseID:SPBC3B9.01 Length:287 Species:Schizosaccharomyces pombe


Alignment Length:124 Identity:20/124 - (16%)
Similarity:41/124 - (33%) Gaps:33/124 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VEQPERP---------KLRVIERQPQLPPNIRPPKMQKR-LRYMRGPEMVHNTLL---------- 84
            :|.|..|         .|.::........|:.|.::..| |:.:..||.....|.          
pombe    51 IEDPSVPLDQKEIAFDNLEMLVEHIDNANNLVPLQLWPRLLKQLESPESTLRRLAAWTIATAVQN 115

  Fly    85 --HKQYAIVATGGGRLRWGHYE-----------MMRLTIGRKMNVNTMFATWRVPAPWQ 130
              ..|.|::...|.::.:|..:           :..:|...|:|...:....::|..|:
pombe   116 NPKSQQALIENDGLKILFGALKKEDSDETKNKVLYAITSELKLNEAGIALLDKIPNSWE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 14/91 (15%)
SPBC3B9.01NP_596658.1 Fes1 1..81 CDD:285773 4/29 (14%)
ARM <76..>132 CDD:304564 10/55 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.