DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5 and AT5G22620

DIOPT Version :9

Sequence 1:NP_569951.1 Gene:Pgam5 / 31143 FlyBaseID:FBgn0023517 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001154730.1 Gene:AT5G22620 / 832325 AraportID:AT5G22620 Length:482 Species:Arabidopsis thaliana


Alignment Length:235 Identity:54/235 - (22%)
Similarity:95/235 - (40%) Gaps:65/235 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RALVRPLRNSQPEEENRYNAELEKAKAKKARHIILVRHG-----EYLDVGDSDDTHHLTERGRKQ 116
            |.|:|    |....::::..|..|       .::|||||     |...:..|.|...||::|..|
plant    29 RLLIR----SSSSLQDQFTVETTK-------RVVLVRHGQSTWNEEGRIQGSSDFSVLTKKGESQ 82

  Fly   117 AEFTGKRLCELGIKWDKVVASTMVRAQETSDII-------------LKQID---FE-------KE 158
            ||.:.:.|  :...:|....|.:.|:::|::||             |::||   |:       ||
plant    83 AEISRQML--IDDSFDVCFTSPLKRSKKTAEIIWGSRESEMIFDYDLREIDLYSFQGLLKKEGKE 145

  Fly   159 KVVNCAFLREGAPIPPQPPVGHWKPEASQFLRDGSRIEAGFRRYFHRA---YPD---QEKESYTL 217
            |... ||.:             |:.:.:.|:.||   ....|..:.||   :|.   .|.:| .|
plant   146 KFGE-AFKQ-------------WQEDPANFIIDG---HYPVRELWSRARSCWPGILAHESKS-VL 192

  Fly   218 IVGHGNVIRYFVCRALQFPAEGWLRININHASITWLTISP 257
            :|.|..|.:..:..|:....|.:..:..::..::.|...|
plant   193 VVAHNAVNQALLATAIGLGTEYFRSLLQSNCGVSVLDFIP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5NP_569951.1 HP_PGM_like 88..265 CDD:132718 48/204 (24%)
AT5G22620NP_001154730.1 His_Phos_1 50..241 CDD:278716 48/203 (24%)
PhoE 264..471 CDD:223483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.