DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14812 and Lamtor5

DIOPT Version :8

Sequence 1:NP_001259144.1 Gene:CG14812 / 31137 FlyBaseID:FBgn0026090 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001099932.1 Gene:Lamtor5 / 295357 RGDID:1305005 Length:156 Species:Rattus norvegicus

Alignment Length:88 Identity:30/88 - (34%)
Similarity:44/88 - (50%) Gaps:0/88 - (0%)


  Fly     1 MEQQLEKVLAEIAARQDTVGALLANRQGLCLGTKGDIDPNVSGIGMAISEQVAKLELNATAPATI 65
            ||..||:.|.:.......||.|..:.|||.||.:|.:....:|:...:::|.|||..:.|....:
  Rat    66 MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVV 130

  Fly    66 CLYSGNKRCVIQKDGEITGVIFK 88
            ||.|.|...:|||...||..:.|
  Rat   131 CLESDNGNVMIQKHDGITVAVHK 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14812NP_001259144.1 LAMTOR5 1..88 CDD:293277 29/86 (34%)
Lamtor5NP_001099932.1 LAMTOR5 66..153 CDD:293277 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355338360
eggNOG 1 0.900 E1_2DG3F
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5292
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006456
OrthoInspector 1 1.000 T1086188
orthoMCL 1 0.900 OOG5_137477
Panther 1 1.100 LDO PTHR13342
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
109.750

Return to query results.
Submit another query.