DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adar and STAU1

Sequence 1:NP_001284791.1 Gene:Adar FlyBaseID:FBgn0026086 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001309861.1 Gene:STAU1 HGNCID:11370 Length:583 Species:Homo sapiens

Alignment Length:313 Identity:73/314 (23%)
Similarity:116/314 (37%) Gaps:105/314 (33%)


  Fly     3 NSANNNSPQHPVSAPSD-----INMNGYNRKLPQKRGYEMPKYSDPKKKMCKERIPQPKNTVAML 62
            |||..::.....||.::     :.:|....||.:|..|   |..||..:|        ::|    
Human    53 NSALPSASITSTSAAAESITPTVELNALCMKLGKKPMY---KPVDPYSRM--------QST---- 102

  Fly    63 NELRHGLIYKLESQTG----------PVHAPLFTISVEVDGQKYLGQGRSKKVARIEAAATALRS 117
                    |....:.|          ||...|:.:.:.|.||::.|:|::::.|:.:|||.||| 
Human   103 --------YNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKALR- 158

  Fly   118 FIQFKDGAVL--SPLKPAGNLDFTSDEHLE-NG----IENLSSSKMFEIIQTMLTEKLSNPTSLE 175
                    :|  .||          .|.|| ||    .|||:.|::.::.:..|...|  |.:.|
Human   159 --------ILQNEPL----------PERLEVNGRESEEENLNKSEISQVFEIALKRNL--PVNFE 203

  Fly   176 QPTFCMSQNVSKSAITVDGQKKVPDKGPVMLLYELFNDVNFECINIDGAQNNCRFKMTVTINEKK 240
              :|.:.|...:|                                  |..:...|...|::.|..
Human   204 --SFPLKQVARES----------------------------------GPPHMKNFVTKVSVGEFV 232

  Fly   241 FDGTGPSKKTAKNAAAKAALASLCNISYSPMVVPQKNVPLPIDDKSSSMELPQ 293
            .:|.|.|||.:|..||.|.|..|..:...|.|   :.|...|..|:..:..||
Human   233 GEGEGKSKKISKKNAAIAVLEELKKLPPLPAV---ERVKPRIKKKTKPIVKPQ 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AdarNP_001284791.1 DSRM 55..117 CDD:214634 18/72 (25%)
seadorna_dsRNA 57..242 CDD:275074 41/202 (20%)
DSRM 203..>251 CDD:214634 9/48 (19%)
ADEAMc 294..665 CDD:214718 73/314 (23%)
STAU1NP_001309861.1 DSRM 186..256 CDD:214634 22/108 (20%)
DSRM 292..358 CDD:238007
Staufen_C 454..563 CDD:293091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121564752
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.