DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG17242

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:208 Identity:54/208 - (25%)
Similarity:98/208 - (47%) Gaps:16/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYK 139
            |.|.|.|.|:||..|||.|.|:    ||.:.:.:.|..|:.:   :::...:::.|::    :.:
  Fly    37 DKHHCGGVIYSEDIILTIAECV----RKARLEFISVRVGSAQ---ENAGGTVLKVEKM----RLQ 90

  Fly   140 KGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAINGDMQI 204
            ....:..|:.::.|.:.|.|...:..|||.....|.|...|:.|||.:....|..:..:..|::|
  Fly    91 VLGLRPSDVAILQLRSPLYLDGGIRAIPLATIPLVPGTNASVSGWGQLSAMNPSSEVLLRVDVKI 155

  Fly   205 LPDTFCEKLLGWS----NAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSA 265
            .....|...|...    :.|.:||....:... :|||..||||:.:|.:.||:|:...|...:.:
  Fly   156 QDQLMCATNLALKGRLMSVGEICAAPAGEIPY-ACQGFVGGPLVANNRLYGILSWQSACDVLNKS 219

  Fly   266 GIYTDVYHFRDWI 278
            .:|.::..|:.||
  Fly   220 SVYANIAMFKVWI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 54/208 (26%)
Tryp_SPc 60..278 CDD:214473 52/206 (25%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 54/208 (26%)
Tryp_SPc 24..232 CDD:214473 52/206 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.