DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Gzmbl1

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_038949997.1 Gene:Gzmbl1 / 502004 RGDID:1561819 Length:277 Species:Rattus norvegicus


Alignment Length:281 Identity:80/281 - (28%)
Similarity:118/281 - (41%) Gaps:42/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PSKFVVYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLR-M 66
            |.|..:.:||::.|.  ...:|||:                  :.||:..:.|.. .|...|: |
  Rat    27 PGKMKLLLLLLTFSL--APRTQAGE------------------IIGGHEANPNSR-PYMAYLQIM 70

  Fly    67 GKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEE 131
            .|.    ..|..|.|.:..:..:||||||:.|        |::|..|......:....|:|...:
  Rat    71 DKD----SGNKTCGGFLIRKDFVLTAAHCLGS--------KIIVTLGAHNIKEQEKKQQVIPVVK 123

  Fly   132 LLPHPKYKKGKSQKYDIGLILLEADLSLGDAV--AKIPLYNKVPVAGAPCSIVGWGTVIQFGPLP 194
            ::|||.| ..|:...||.|:.|::......||  ..:|..|.....|..|.:.|||.:...|..|
  Rat   124 IIPHPAY-NAKTISNDIMLLKLKSKAKRTSAVKTLNLPRSNFKVKPGDVCYVAGWGKLGPMGEFP 187

  Fly   195 DEAINGDMQILPDTFCEKLLG--WSNAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGM 257
            |.....::.:..|..||..|.  :..|..:||.|.:.... |.||||||||:|..:..||||:|.
  Rat   188 DTLQEVELTVQEDQKCESHLTNVYDKANEICAGDPNIKRA-SFQGDSGGPLVCKKVAAGIVSYGR 251

  Fly   258 GCGEPDSAGIYTDVYHFRDWI 278
            ..|.....  :|.|..|..||
  Rat   252 KDGSTPRE--FTKVSTFLSWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 69/224 (31%)
Tryp_SPc 60..278 CDD:214473 67/222 (30%)
Gzmbl1XP_038949997.1 Tryp_SPc 50..273 CDD:238113 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.