DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG11836

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:344 Identity:93/344 - (27%)
Similarity:145/344 - (42%) Gaps:82/344 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KFVVY----------ILLISVSANSNSESQAGQLHSAPSQRQDR-PSDFQFLVTGGYR-----PD 53
            |::::          :|.:..|...|.......:|:..::|..: ..|..|.::.|..     .|
  Fly     4 KYIIFFWMLTANYSSVLSLEYSKGFNESDAINTIHTGHNKRTSKFLFDTIFRISSGVSNAFGLSD 68

  Fly    54 TNDLVKYT------------------VSLRMGKP---------KKFFGDNHF-CAGTIFSERAIL 90
            |.|.|:||                  :.:..|||         .:...|..| |.|::.::..:|
  Fly    69 TEDEVEYTENSSLKNCDCDCGFSNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVL 133

  Fly    91 TAAHCMFSNRRKLKAKKLMVVAG-------TPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKY-- 146
            :||||:    :||:..|:.|:.|       :..:.::.:.|.:|         |:|......|  
  Fly   134 SAAHCV----KKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVI---------KHKSFDPDTYNN 185

  Fly   147 DIGLILLEADLSLGDAVAKI--PLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAINGDMQILPDTF 209
            ||.|:.|...:|....:..|  |.||..| ||...::||||...:.|.||.......:.|:..|.
  Fly   186 DIALLRLRKPISFSKIIKPICLPRYNYDP-AGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITE 249

  Fly   210 CEKLLGWS---NAGMLCANDKHDSDVDSCQGDSGGPLICDN----MVTGIVSFGMGCGEPDSAGI 267
            |......|   .:.||||.   ...:|||||||||||:..|    .:.||||:|:|||.....|:
  Fly   250 CRNQRYKSTRITSSMLCAG---RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGV 311

  Fly   268 YTDVYHFRDWI---TENSC 283
            |:.|..|..||   .||:|
  Fly   312 YSRVSKFIPWIKSNLENTC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 77/269 (29%)
Tryp_SPc 60..278 CDD:214473 75/263 (29%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.