DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG9672

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:314 Identity:72/314 - (22%)
Similarity:110/314 - (35%) Gaps:104/314 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KFVVYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLV----KYTVSLR 65
            |..:.|.||.|:        ||.|.:.|..|          :.||     .|.|    .|..:|.
  Fly     2 KLTLTIGLILVA--------AGVLEAQPQGR----------IAGG-----EDAVLGQLPYQAALS 43

  Fly    66 MGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTT------ 124
            :       |.::.|...|..:|..|||..|:.|:.:           .||...:..:.|      
  Fly    44 I-------GGSYNCGAVIIGQRYALTALSCVCSDGK-----------DTPWAAVLFAVTVGSVDL 90

  Fly   125 ---QIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWG- 185
               :.|..||:..:|.|   .:.|..|.|:.|:.:::..:.|..|||...||..|:...:.||| 
  Fly    91 YNGKQIRVEEITINPNY---STLKTGIALLRLQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGR 152

  Fly   186 ---------TVIQFGPLP------------DEAINGDMQILPDTFCEKLLGWSNAGMLCANDKHD 229
                     ..:|.|...            ||.:..|.|:|    |   ||            |.
  Fly   153 TTESEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVL----C---LG------------HG 198

  Fly   230 SDVDSCQGDSGGPLICDNMVTGIVSFGMG-CGE--PDSAGIYTDVYHFRDWITE 280
            .....|.||.|||.:....:.|:.:..:| ||.  |:.   :..:....|||.:
  Fly   199 RRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPER---FISIAANYDWIQQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 58/255 (23%)
Tryp_SPc 60..278 CDD:214473 56/251 (22%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 61/280 (22%)
Tryp_SPc 25..250 CDD:238113 62/273 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.