DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and CG30323

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:344 Identity:90/344 - (26%)
Similarity:133/344 - (38%) Gaps:96/344 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFG 74
            :||::.||.|| |.:.|      .||       ...||..|..:       .||:|..|..:.:|
  Fly     6 LLLLTSSAYSN-EGKKG------LQR-------NLYVTDNYHQN-------VVSIRTRKHIRHWG 49

  Fly    75 DNHFCAGTIFSERAILTAAHCMF----------SNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEA 129
            |||||||::.|...::|:..|:.          |||     |.|.||..||:||.|.|...|...
  Fly    50 DNHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNR-----KNLRVVVFTPKRLKKPSPKNIYHV 109

  Fly   130 EELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWG--------- 185
            ::::.......|.::     |.||:.|..:......:.|..|...:...|:.:|||         
  Fly   110 QKIVLDESAISGCTE-----LALLKLDRGVTGQRFAMMLPEKELNSTWLCNSLGWGRIYYVSYVY 169

  Fly   186 ----------------TVIQFGPLPDEAIN------GDMQILPDTFCEKLL---GWSNAGMLCAN 225
                            |..|.||...|.|.      .:.:..||  |.:.|   .::..|     
  Fly   170 ISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPD--CSRCLCMTSYTGRG----- 227

  Fly   226 DKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAG--IYTDVYHFRDWI--TENSCPLG 286
                   :.||.|.|.||.||:.:.|:......|   |..|  .||::|..|.:|  |.:.....
  Fly   228 -------NMCQQDLGSPLFCDHFLYGVARRVHTC---DDEGFMFYTNIYQNRKFIEDTLSGATWP 282

  Fly   287 TRSVWTLFLLLLLLLTGIS 305
            .|.:....|||||:|..:|
  Fly   283 KRVLCFRLLLLLLVLASLS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 69/268 (26%)
Tryp_SPc 60..278 CDD:214473 67/263 (25%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 64/256 (25%)
Tryp_SPc 45..272 CDD:214473 63/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.