DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and Klk1b21

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_011249110.1 Gene:Klk1b21 / 16616 MGIID:892022 Length:296 Species:Mus musculus


Alignment Length:321 Identity:78/321 - (24%)
Similarity:125/321 - (38%) Gaps:77/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KFVVYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKP 69
            :|::..|.:|:          |::.:||        ..|..:.||:..:.|....:....|..| 
Mouse     2 RFLILFLALSL----------GEIDAAP--------PVQSRIVGGFNCEKNSQPWHVAVFRYNK- 47

  Fly    70 KKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLP 134
                   :.|.|.:.:...:|||||| :.|    ...:..|..|..:.....|:.|.....:..|
Mouse    48 -------YICGGVLLNPNWVLTAAHC-YGN----ATSQYNVWLGKNKLFQHESSAQHRLVSKSFP 100

  Fly   135 HPKYKKGKSQKY----------DIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSIVGWGTVI- 188
            ||.|.......:          |:.|:.|.....:.|||..|.|..:.|..|:.|...|||::. 
Mouse   101 HPDYNMSLMNDHTPHPEDDYSNDLMLLRLSKPADITDAVKPIDLPTEEPKLGSTCLASGWGSITP 165

  Fly   189 --------------------------------QFGPLPDEAINGDMQILPDTFCEK-LLGWSNAG 220
                                            ..|.:|::...|.::.||:..|.| .:......
Mouse   166 TKCESAPRNIARCRGGAEGPGLGPVHHPLSLSSTGQIPNDLQCGFIKPLPNENCAKAYIHKVTDV 230

  Fly   221 MLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFG-MGCGEPDSAGIYTDVYHFRDWITE 280
            ||||.:. ....|:|.||||||||||.::.||.|:| :.|.:|::..|||.:..|..||.:
Mouse   231 MLCAGEM-GGGKDTCAGDSGGPLICDGVLQGITSWGSIPCAKPNAPAIYTKLIKFTSWIKD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 68/266 (26%)
Tryp_SPc 60..278 CDD:214473 66/262 (25%)
Klk1b21XP_011249110.1 Tryp_SPc 25..291 CDD:238113 71/280 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.