DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and AgaP_AGAP002543

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_312395.5 Gene:AgaP_AGAP002543 / 1273420 VectorBaseID:AGAP002543 Length:274 Species:Anopheles gambiae


Alignment Length:254 Identity:73/254 - (28%)
Similarity:118/254 - (46%) Gaps:24/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VTGGYRPDTNDLVKYTVSLRMGKPKKFFGDN-----HFCAGTIFSERAILTAAHCMFSNRRKLKA 105
            :.||.  ..|:.:.|.:||:: ....|||..     |.|.|:|.:|..::|||||:..    :..
Mosquito    28 IVGGM--TANERIPYQISLQV-LVSSFFGFGPKRWMHNCGGSIVNEYYVVTAAHCLDG----MDI 85

  Fly   106 KKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYN 170
            .::.:||||......||.......|..:.||.|.  :..:.|||::.::...:..:.|..|...:
Mosquito    86 NRMSIVAGTNDLRNDSSKGTRYFLESYMIHPDYI--ELNRSDIGVMRVKEAFTFNENVQPIRYSS 148

  Fly   171 KVPVAGAPCSIVGWGTV--IQFGPLPDEAINGDMQILPDTFCEKLLGWSNAGMLCANDKHDSDVD 233
            .....|..|.:.|||..  |:.|..|.:....::..:.:..|.:.....|...:|...:...  .
Mosquito   149 DFVGGGVTCLLTGWGYTMPIRVGSTPKDLQEAELTTITNDQCRERGMPVNPTEICTFTRVGQ--G 211

  Fly   234 SCQGDSGGPLICDNMVTGIVSFG---MGCGEPDSAGIYTDVYHFRDWITENSCPLGTRS 289
            :|.|||||||:|:|.::|:||:|   .|.|.||   :||.|..|..||.||:...|:.|
Mosquito   212 ACGGDSGGPLVCNNQLSGVVSYGTRYCGIGVPD---VYTRVSEFDSWIQENTQTSGSSS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 66/230 (29%)
Tryp_SPc 60..278 CDD:214473 64/227 (28%)
AgaP_AGAP002543XP_312395.5 Tryp_SPc 27..256 CDD:214473 67/241 (28%)
Tryp_SPc 28..259 CDD:238113 69/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.