DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and AgaP_AGAP010661

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_311381.4 Gene:AgaP_AGAP010661 / 1272469 VectorBaseID:AGAP010661 Length:175 Species:Anopheles gambiae


Alignment Length:152 Identity:43/152 - (28%)
Similarity:71/152 - (46%) Gaps:23/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 STTQ-----IIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPVAGAPCSI 181
            ||||     |.:|.:::.||.|.. ::..||..::.::......|.:|.|.|.:....:...|..
Mosquito     7 STTQTRGGVIFQASKIVIHPYYNP-ETHDYDAAIVEIKTSFQGYDNIAPIALQDAEVPSDTTCYA 70

  Fly   182 VGWG-------TVIQFGPLPDEAINGDMQILPDTFCEKLLG-WSNAGMLCANDKHDSDVDSCQGD 238
            .|||       |.      ||......:|::....|....| ::...::||...::.||  |:||
Mosquito    71 AGWGLNNYDRRTT------PDNLQYATLQVITQQQCSAAWGSYATPQVICAQQNNNGDV--CKGD 127

  Fly   239 SGGPLICDNMVTGIVSF-GMGC 259
            ||||.:|:..:||..|: |:||
Mosquito   128 SGGPFVCNGKLTGATSYGGIGC 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 43/152 (28%)
Tryp_SPc 60..278 CDD:214473 43/152 (28%)
AgaP_AGAP010661XP_311381.4 Tryp_SPc <1..172 CDD:238113 43/152 (28%)
Tryp_SPc <1..162 CDD:214473 43/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.