DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3795 and plaua

DIOPT Version :9

Sequence 1:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:272 Identity:73/272 - (26%)
Similarity:125/272 - (45%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRR 101
            :|..|.|..:.||.|.        ||..:......|.||...|.||:.:...:|||||| |...:
Zfish   155 ERRLDRQTKIIGGLRS--------TVESQPWMAAIFKGDGFICGGTLITPCWVLTAAHC-FPTGK 210

  Fly   102 KLKAKKLMVVAG-------TPRRLLKSSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSL 159
            :.:..:..||.|       .|.:..|.:.::::..|:.    .|.. ::..:||.|:.:| |.: 
Zfish   211 RTQINRYSVVLGKNAINETDPVKEQKFTVSRLVIHEDF----DYST-ENYTHDIALLKIE-DCN- 268

  Fly   160 GDAVAK--------IPLYNKVPVAGAPCSIVGWGT----VIQFGPLPDEAINGDMQILPDTFCEK 212
            |....|        :|.:.::...|..|.|.|:|.    ..:|.....:.   :::::....|::
Zfish   269 GQCAVKTKTVRTACLPPFQQMLPVGFYCEIAGYGRYQKGTFKFSRYLKQT---EVKLISQKVCQR 330

  Fly   213 LL---GWSNAGMLCANDKHDSDVDSCQGDSGGPLICD----NMVTGIVSFGMGCGEPDSAGIYTD 270
            ..   ...|..|||||.: |...|:|||||||||:|:    ..:.||:|:|..|.|.:..|:||.
Zfish   331 TYYNKDEVNENMLCANGR-DWKTDACQGDSGGPLVCEVNNIMFLFGIISWGKECAEKNQPGVYTQ 394

  Fly   271 VYHFRDWITENS 282
            |.::..||::::
Zfish   395 VSNYNQWISQHT 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 67/246 (27%)
Tryp_SPc 60..278 CDD:214473 65/243 (27%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.