DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32809 and SRCIN1

DIOPT Version :8

Sequence 1:NP_001245466.1 Gene:CG32809 / 31121 FlyBaseID:FBgn0023531 Length:1264 Species:Drosophila melanogaster
Sequence 2:XP_016880658.1 Gene:SRCIN1 / 80725 HGNCID:29506 Length:1479 Species:Homo sapiens

Alignment Length:1607 Identity:360/1608 (22%)
Similarity:564/1608 (35%) Gaps:568/1608 (35%)


  Fly    11 SASSNQSVGGSSSSSSKKKRKGREGEDWQNEAKSGRLPSNEQGGDERRRAMR-RDDPRRHTLGG- 73
            :|.|.:::.|...:.:.:||     :.:.:..|| :.|       :...|:| :.|..|..:|| 
Human    46 AAQSLEALSGLQKADADRKR-----DAFMDHLKS-KYP-------QHALALRGQQDRMREQVGGW 97

  Fly    74 ---DMLVYGSQHPHAH-QMAPQ-----QQRAMDLEMSTRAQKNKKNQPMRGYAPVNQGPLFDDDP 129
               .:.:..|...|.| ..||.     .|:.......||:.::            .||.    .|
Human    98 TVDPVCLLSSLCSHLHGDSAPSGAGQPAQQPNYWSFKTRSSRH------------TQGA----QP 146

  Fly   130 GI-----------------MSEVETASTGFRRGGKQRSSLPVVRTPSKTLERPLGLVFLQYRSET 177
            |:                 |||.| ...||.|..:.|.|||:.|:.|:|..|..|::|||:..||
Human   147 GLADQAAKLSYASAESLETMSEAE-LPLGFSRMNRFRQSLPLSRSASQTKLRSPGVLFLQFGEET 210

  Fly   178 KRALLPNEITSIDTVRALFVRSFPRQLTMSYLEGPNVKIYIHDASKDMFYELEDVRSHLREIRDR 242
            :|..:.:|::|:||:.||....||::|||..|:.||..|.|.|.::::|||||||    |:|:||
Human   211 RRVHITHEVSSLDTLHALIAHMFPQKLTMGMLKSPNTAILIKDEARNVFYELEDV----RDIQDR 271

  Fly   243 SVLRLF--ESTEVAAPPQILPGG----------------------------------PGIPQPLP 271
            |:::::  |....|.|...|..|                                  ||:|..||
Human   272 SIIKIYRKEPLYAAFPGSHLTNGDLRREMVYASRESSPTRRLNNLSPAPHLASGSPPPGLPSGLP 336

  Fly   272 QAQANWDQDQSYFS----EPEFDSDYKHQHIHKS--KIGKQPAPYYVGSSQT--LPR-------- 320
            ....:....:|..|    .|   ..|....:|.:  ::|..||...|..|.:  |.|        
Human   337 SGLQSGSPSRSRLSYAGGRP---PSYAGSPVHHAAERLGGAPAAQGVSPSPSAILERRDVKPDED 398

  Fly   321 --------------GMYSS-----ERNKVSMGAPV-KPLR-----SLNPRGSMEPLFPYT----- 355
                          |:|:.     ...::|:.|.. .|..     .|..|||:..|..|:     
Human   399 LASKAGGMVLVKGEGLYADPYGLLHEGRLSLAAAAGDPFAYPGAGGLYKRGSVRSLSTYSAAALQ 463

  Fly   356 ---PDQLYSIP--------DGY-----TSSPER-----SSRGNYEEPY--YSQYGTRGAVV---- 393
               .|.||...        |||     .|||::     :..|....|:  ||...:||:.|    
Human   464 SDLEDSLYKAAGGGGPLYGDGYGFRLPPSSPQKLADVAAPPGGPPPPHSPYSGPPSRGSPVRQSF 528

  Fly   394 ------APIIDEEQSDGTMTEDQYALYG-----IKVGPGPNRLTHRGNQI--------YDP---- 435
                  :.:..|.....|.:....:..|     :..|||...|...|..:        .||    
Human   529 RKDSGSSSVFAESPGGKTRSAGSASTAGAPPSELFPGPGERSLVGFGPPVPAKDTETRRDPMLRG 593

  Fly   436 --TRPEDLHRIRVEHMERQLANLTGLVQKALVNQNPQIAPLAVPTLDPNYLVVPSQMQANGSGDE 498
              .:...|.|.|:|.||:|:|:||||||.||:..:....|                         
Human   594 EVAQTPFLPRERMEAMEKQIASLTGLVQSALLRGSEPETP------------------------- 633

  Fly   499 LYIREKAPKLGKNSCQKSVSFEKSVSFSDDIQGIPKSHNPLHAAETKPTKPAIKSSTLPRTSSQE 563
                                       |:.|:|...:..|     :.|.....:||.....|.  
Human   634 ---------------------------SEKIEGSNGAATP-----SAPCGSGGRSSGATPVSG-- 664

  Fly   564 RDRLKPPPPPKPIVLAQTAHPNYRADIALAPEVYNHLRGLQKKAKDLRMEVRTLRRLSQAQAVAV 628
                  ||||     :.::.|..:.......::..||||||..|.|||.:::.||:|......:|
Human   665 ------PPPP-----SASSTPAGQPTAVSRLQMQLHLRGLQNSASDLRGQLQQLRKLQLQNQESV 718

  Fly   629 REDIKGT----FMRIRATLLASSGSFWDHQGDQDATR-----ISREEELYKQEVIR-------LE 677
            |..:|.|    .||:                 .:|.|     :.|:..|.::|.:|       :.
Human   719 RALLKRTEAELSMRV-----------------SEAARRQEDPLQRQRTLVEEERLRYLNDEELIT 766

  Fly   678 KDLSDLEGSVENLRGEVINRRTRVNMTAVEDMALVLSRASKTVAELKLKFPSLSNGLRCILSNEM 742
            :.|:|||.|||.::.:|.:....|....:|:.||||.:..:|:.|||..||.|.:.:|.:|..|:
Human   767 QQLNDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEV 831

  Fly   743 EKVVREEKFLKEEPDRLESALRRCKKLTGTLVTLKRLASVQEQRLPPNEPTISE-------ETP- 799
            |.|    |||||||.||:..|:||:.:|.||..::|  .|.|...||....:|:       ||. 
Human   832 EAV----KFLKEEPQRLDGLLKRCRGVTDTLAQIRR--QVDEGVWPPPNNLLSQSPKKVTAETDF 890

  Fly   800 -RSADISAPDKPIPTPRMGSFALSG----------GLAPENALDA----LLDELKTFSKPIAQQQ 849
             :|.|.   :.|.|:|.:....|||          |..|...||.    .:|  |..|...|::.
Human   891 NKSVDF---EMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGLDTPGKRSVD--KAVSVEAAERD 950

  Fly   850 QQQQQQQQQQQ---------QQHQHQQLYEIRPEDSASD----------------ESAQAAVQST 889
            .::::....|.         ::.|.:.|..|...|.||.                ...|.|...|
Human   951 WEEKRAALTQYSAKDINRLLEETQAELLKAIPDLDCASKAHPGPAPTPDHKPPKAPHGQKAAPRT 1015

  Fly   890 V------TTQISQARLYTE----------------ASVNVQQATTGSMVIAVASGTVSAQAQAQR 932
            .      :.:::..|..||                :|..:....||.:|:.           :::
Human  1016 EPSGRRGSDELTVPRYRTEKPSKSPPPPPPRRSFPSSHGLTTTRTGEVVVT-----------SKK 1069

  Fly   933 GVLTHQQSQSQAQLMVHTNMGSLRRLHSYPSESDGELPGPPPTGP-------------------R 978
            .....::::|: :|.|......|||..|       |:..|..|.|                   .
Human  1070 DSAFIKKAESE-ELEVQKPQVKLRRAVS-------EVARPASTPPIMASAIKDEDDEDRIIAELE 1126

  Fly   979 ASETSSSTSLANGGSSSKPPVPERNAELI-TKVGHKRIPPP----PPPRTSSRS----------- 1027
            ..|.||.:||        ||.|.|  :|| |.:..:.:.||    |.|....|:           
Human  1127 VFERSSVSSL--------PPTPRR--QLIPTLLSPQDLGPPGGSAPGPTRKHRATEPGEREVALS 1181

  Fly  1028 --PLASP--------------------TSPNVPPNQAAAATVNLIPNSNSNASANANANANSNAT 1070
              |:::|                    .:|| ||:...|....|.|.:.........|::.....
Human  1182 AFPVSTPHFQAAPGPRAFCVPRIILTECAPN-PPSPPEARLEELGPRTAPTPRPQTLADSTRGWD 1245

  Fly  1071 GNK---GIVGETTSVVSGDTSS-------------GDNSSGNESGNDHVQ-----------RQVA 1108
            |.:   |:||||    ||..||             |...|..|.|...||           ....
Human  1246 GPQSPPGVVGET----SGPRSSFMPRKEGAALKRLGGGGSSLEDGGARVQCPQGPAQDGTPETST 1306

  Fly  1109 LEMRHQELLKKQKMLQEQYQRLQQMSKLPSVDVASSS-----SSSAQDIASGSNTLRKLGSETNI 1168
            .:...:|:||      :.....|..|:......|::|     .::||.:.|...|||:|      
Human  1307 ADTYPEEILK------DSGHDAQTCSREHQGQAAANSGRTTWGATAQQMDSLEETLREL------ 1359

  Fly  1169 QQKIAALSLACETSGAAAAAAAAAAAAATNGGVVASDATSGA---------IGGGG--------- 1215
                                    .|..:|.|...:..:.|:         .|||.         
Human  1360 ------------------------EATLSNMGTGPAMGSPGSPPPLPLRPQSGGGSVPPMKVVTP 1400

  Fly  1216 GA----GAAGAAGASAAAAHSNSNSNSNLNLNLNSQHQTATTTTKQL 1258
            ||    .|.|.||:...:.|....:.   .:.:.:|.| ||..:|::
Human  1401 GASRLKAAQGQAGSPDKSKHGKQRAE---YMRIQAQQQ-ATKPSKEM 1443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32809NP_001245466.1 AIP3 170..>247 CDD:281852 35/77 (45%)
SRCIN1XP_016880658.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108827534
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I3040
Isobase 1 0.950 0 Normalized mean entropy S8094
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001688
OrthoInspector 1 1.000 T609273
orthoMCL 1 0.900 OOG5_131039
Panther 1 1.100 O PTHR22741
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.