DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hfw and swi2

DIOPT Version :8

Sequence 1:NP_001259135.1 Gene:hfw / 31120 FlyBaseID:FBgn0001189 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_611247.3 Gene:swi2 / 37010 FlyBaseID:FBgn0034262 Length:499 Species:Drosophila melanogaster

Alignment Length:551 Identity:134/552 (24%)
Similarity:217/552 (39%) Gaps:137/552 (25%)


  Fly   105 DTTSTSTSHSTSTTSTTSPAPLPPAAPEQPEYLKHCFYAEEQLCGHTFDGRAETSEGQGSTVAQS 169
            |:..|||..:|.||.||...|:|.:.       :.||            |.:...|..|...::|
  Fly    32 DSHETSTLLATITTITTEIIPMPDSG-------RSCF------------GWSSAPEAAGGNCSRS 77

  Fly   170 EAQNRGGQGNSQCQCREHPTRPNSWYCCNISQLTMISSCSNISKWTNLHVRNMTVEDMDLSNPIF 234
               ||  .|..:|....:          |::.|......|.:.....:.:.....:.::    .|
  Fly    78 ---NR--NGTLKCYGGMN----------NLAALNQSGKLSRVQPALEMLLCGWPKDGLN----HF 123

  Fly   235 RSLQ------SLAVTDGNITRLVNAFPRLSALKCLNISNNNISEIHSRAVKDVPHLEFFGMSNNN 293
            |.||      ||.:.....|.....||.:..|..:|||..|:|.|.||..|.|..|:...:..|.
  Fly   124 RDLQKLPRLRSLTIEYSGFTEFKFDFPEMLELHTINISWTNLSYISSRTFKRVHPLKVLDLRWNQ 188

  Fly   294 LSLVPHRNQNKNITLDISGNMRMLCTPLN-EIIYTESINFLNPKHSYCQYNATHT--WFQ----- 350
            |           |.||     ..|..|.| |.:|...    ||      :|.|..  |..     
  Fly   189 L-----------IQLD-----GPLLLPRNFEQLYLAG----NP------WNCTRNFKWLLLQPEK 227

  Fly   351 -----------STDKVSVE---------QLENRKRCVTNCPVIPNYGSCNCTLENIMIIQDNQSK 395
                       .||:...|         :||.:::|.::    .:..:|.|.:.:|:        
  Fly   228 GRLVVDRDELICTDRKYKERQMLMVMHYKLELKRQCQSH----EDLRNCTCLMHHIL-------- 280

  Fly   396 PQCH-----VDCSNLGLVELPQRLPDNTFMLNITNNKITSLGDYFHTNPTYHNINRLLADNNQIS 455
            |:.|     |:||:|....||..|||||..|.|.:|.|:.:.. ...||.|.::..:..:|||||
  Fly   281 PKTHIPLYTVNCSHLQFHRLPDFLPDNTTTLVINDNMISDINP-LRDNPHYRHVVDMQLENNQIS 344

  Fly   456 SIYEFEGTKFIETFQRIYMRNNSLSKIPEYFLNNALMDSGLGRRIYLAGNKLQCDCNSAKTLQNW 520
            ::...|.|.:::.|:.:.:|.|:|.|:..|.|:|||.|:.....:.|:.|...|.|.....::..
  Fly   345 NVDNLEDTYWLQNFRLLNLRGNNLRKLHVYALDNALDDNENANLLLLSRNPWHCTCKFGSRMREL 409

  Fly   521 LKERSSDIPDYMEIRCR------NMPQRVIELQEAKLCQ---------SPPDWTDYIYYLIAAEV 570
            |.:....:.|...:.|.      .:..:|:.|...::|.         .|.||.:.:   :|:.:
  Fly   410 LTKYKDIVRDAWNVSCTYRLDDDQLLAKVLTLSRQEMCNLSVEGGTQIHPIDWLNGV---LASLI 471

  Fly   571 LLLLALITKVSYDYWVFKTAGYLPWPASKMP 601
            .|:|.   |::|||:.:|..|.:||...|||
  Fly   472 FLILG---KLAYDYYYYKYYGRVPWIVMKMP 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hfwNP_001259135.1 LRR_8 235..294 CDD:290566 21/65 (32%)
leucine-rich repeat 237..259 CDD:275378 7/28 (25%)
leucine-rich repeat 260..283 CDD:275378 11/23 (48%)
leucine-rich repeat 284..304 CDD:275378 3/20 (15%)
leucine-rich repeat 420..443 CDD:275378 7/23 (30%)
leucine-rich repeat 444..465 CDD:275378 7/21 (33%)
leucine-rich repeat 466..497 CDD:275378 11/31 (35%)
leucine-rich repeat 498..509 CDD:275378 2/11 (18%)
swi2NP_611247.3 LRR <117..384 CDD:227223 83/310 (27%)
leucine-rich repeat 132..154 CDD:275378 5/22 (23%)
leucine-rich repeat 155..178 CDD:275378 11/23 (48%)
leucine-rich repeat 179..201 CDD:275378 8/38 (21%)
leucine-rich repeat 202..214 CDD:275378 5/22 (23%)
leucine-rich repeat 287..307 CDD:275378 9/20 (45%)
leucine-rich repeat 308..332 CDD:275378 8/25 (32%)
leucine-rich repeat 333..357 CDD:275378 7/24 (29%)
leucine-rich repeat 358..385 CDD:275378 11/27 (41%)
leucine-rich repeat 386..398 CDD:275378 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24366
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.