DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-38 and tpx2

DIOPT Version :8

Sequence 1:NP_001334676.1 Gene:mei-38 / 31104 FlyBaseID:FBgn0260986 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_017208988.1 Gene:tpx2 / 107966129 ZFINID:ZDB-GENE-030131-9652 Length:739 Species:Danio rerio

Alignment Length:277 Identity:68/278 (24%)
Similarity:111/278 (40%) Gaps:60/278 (22%)


  Fly    82 PKDTTEASKDALTIKPKVEPHDVPELKLKTELQELAQVSPLDNGPEPQDDIK---QIVPLNWGKD 143
            |:....|.|..:.|:.|.|     |.|....::.||....|...|:|  .:|   ::.|.:: ::
Zfish   478 PESPAFALKSRVRIEKKKE-----EEKPPAPIKALAVPHYLPFQPKP--PVKSQVEMCPFSF-EE 534

  Fly   144 GDDDEKHMTEADQHLVHQERPPGVGAKLRLEWSPPRHREH--EGAGASATSAAPKAYQFKDVYES 206
            .|.:.|.|.|.....:..|..|    |.:.:..|..|..|  |.....||..||    ||.:.: 
Zfish   535 RDRERKMMKEKKLEELRNEEVP----KFKAQPLPDFHEVHLPEKKVQEATKPAP----FKLMID- 590

  Fly   207 KRQQAMRKRSEEESKARQFHSRPMPNFKAMHKRMNELAVIHKITVPRTPETLKHSQSNVERRRDD 271
            :|..|..:|.|:..|....|......|||                  .|.|:.:.:..|      
Zfish   591 ERGAARSERWEQMMKEELKHQAEAACFKA------------------RPNTVSYKEPFV------ 631

  Fly   272 DPADQARLHPAGTRS----RPFHLRSEQRVRDRREFD------AAVQVSLEQKKKEQDEQRKRCE 326
             |..:.|...|.|.:    ..|.|.:|:|.::|.||:      .|::..:|:::..:.||:   |
Zfish   632 -PKKENRSILANTTNSAVPEGFQLATERRAKERLEFEKELSEREALRARMEEERAREREQQ---E 692

  Fly   327 QEEIKELRKMTAFKARP 343
            :|||..||:....||:|
Zfish   693 KEEIARLRQEQVCKAQP 709



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132258
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.