DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pck and sinu

Sequence 1:NP_569919.2 Gene:pck FlyBaseID:FBgn0013720 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_647971.3 Gene:sinu FlyBaseID:FBgn0010894 Length:247 Species:Drosophila melanogaster

Alignment Length:220 Identity:66/221 (30%)
Similarity:103/221 (47%) Gaps:16/221 (7%)


  Fly    24 RATNGVVFGAIVTFASFFVLMMSFCSPYWIES-YEETRASFKNMGLWQYCFKDFVYPKYAFLKQ- 86
            |..:|.....:..|| |..::::|.:|.|:.| |..|.|....:|||.:||:..  |......| 
  Fly    32 RTLSGSCGVGVFVFA-FAFIVIAFATPSWLVSDYRITGAKLDRLGLWVHCFRSL--PDVNDDSQR 93

  Fly    87 --FTGC---HNIFSHEYYVIREYLLPGWLMAVQGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQY 146
              |.||   ::.|:..|..||.:|||.:::|.|.|.|::| |..||.|:..|..|.........:
  Fly    94 RFFVGCRWVYDPFTTGYDEIRGFLLPAFMIATQFFYTLAF-IGMLVSAIGVLVFILCAGPDQKHF 157

  Fly   147 EWLLVRLSY--MGTAISSLFMFLAVCIFGGCAYRRDWMMYPKFNVLGWSYALAVVTFMLLGLAAL 209
            ..|:..|.|  :|..:|:.   :||.:|.|...|..||.....|..|||:.||.|..:|..:|:.
  Fly   158 ITLIKSLGYVLLGAGVSAA---IAVIVFAGFGNRNGWMPEHANNWFGWSFILACVGTVLTLVAST 219

  Fly   210 ILQREARQAYDARGEQKNLVMQMEM 234
            :...||...:..|.:.|....:.|:
  Fly   220 LFLSEAHVQHKKRIQFKESQTRFEL 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pckNP_569919.2 PMP22_Claudin 39..211 CDD:304458 57/181 (31%)
sinuNP_647971.3 Claudin_2 44..223 CDD:290614 59/186 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131192891
eggNOG 1 0.900 E1_2CKEE
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21284
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.