DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pck and sinu

DIOPT Version :9

Sequence 1:NP_569919.2 Gene:pck / 31101 FlyBaseID:FBgn0013720 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_647971.3 Gene:sinu / 46187 FlyBaseID:FBgn0010894 Length:247 Species:Drosophila melanogaster


Alignment Length:220 Identity:66/220 - (30%)
Similarity:103/220 - (46%) Gaps:16/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RATNGVVFGAIVTFASFFVLMMSFCSPYWIES-YEETRASFKNMGLWQYCFKDFVYPKYAFLKQ- 86
            |..:|.....:..|| |..::::|.:|.|:.| |..|.|....:|||.:||:..  |......| 
  Fly    32 RTLSGSCGVGVFVFA-FAFIVIAFATPSWLVSDYRITGAKLDRLGLWVHCFRSL--PDVNDDSQR 93

  Fly    87 --FTGC---HNIFSHEYYVIREYLLPGWLMAVQGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQY 146
              |.||   ::.|:..|..||.:|||.:::|.|.|.|::| |..||.|:..|..|.........:
  Fly    94 RFFVGCRWVYDPFTTGYDEIRGFLLPAFMIATQFFYTLAF-IGMLVSAIGVLVFILCAGPDQKHF 157

  Fly   147 EWLLVRLSY--MGTAISSLFMFLAVCIFGGCAYRRDWMMYPKFNVLGWSYALAVVTFMLLGLAAL 209
            ..|:..|.|  :|..:|:.   :||.:|.|...|..||.....|..|||:.||.|..:|..:|:.
  Fly   158 ITLIKSLGYVLLGAGVSAA---IAVIVFAGFGNRNGWMPEHANNWFGWSFILACVGTVLTLVAST 219

  Fly   210 ILQREARQAYDARGEQKNLVMQMEM 234
            :...||...:..|.:.|....:.|:
  Fly   220 LFLSEAHVQHKKRIQFKESQTRFEL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pckNP_569919.2 PMP22_Claudin 39..211 CDD:304458 57/180 (32%)
sinuNP_647971.3 Claudin_2 44..223 CDD:372799 59/185 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447767
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21284
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.