DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pck and Cldnd1

Sequence 1:NP_569919.2 Gene:pck FlyBaseID:FBgn0013720 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006248268.1 Gene:Cldnd1 RGDID:1359273 Length:276 Species:Rattus norvegicus

Alignment Length:246 Identity:46/247 (19%)
Similarity:84/247 (34%) Gaps:76/247 (31%)


  Fly    24 RATNGVVFGAIVTFASFFVLMMSFCSPYWIE--------SYEETRASFK---------------- 64
            |.....|...:::..|...:..|..:.:|.|        |.:..|.:::                
  Rat    27 RFATAFVIACVLSLISTIYMAASIGTDFWYEYQSPAQENSSDANRIAWEDFMGDEADEKTYNDAL 91

  Fly    65 -----NMGLWQYCFKDFVYPK----YA------FLKQFTGCHNIFSHEYYVIREYLLPG------ 108
                 |:|||:.|   ...||    ||      ..:..|.|.:...:|.: :.:|:.||      
  Rat    92 FRYNGNLGLWRRC---ITIPKNTHWYAPPERTESFEVVTKCMSFTLNEQF-MEKYVDPGNHNSGI 152

  Fly   109 -----WLMAVQGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQYEWLLVRLSYMGTAISSLFMFLA 168
                 :|...|      |::.|:.|.|:.       ..|::.....:.|..|...|...|.:...
  Rat   153 DLLRTYLWRCQ------FLLPFVSLGLMC-------FGALIGLCACVCRSLYPTIATGILHLLAG 204

  Fly   169 VCIFG--GCAYRRDWMMYPKFNV-------LGWSYALAVVTFMLLGLAALI 210
            :|..|  .|......:::.|..:       .|||:.||.|:..|..:|:.:
  Rat   205 LCTLGSVSCYVAGIELLHQKLGLPKNVSGEFGWSFCLACVSAPLQFMASAL 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pckNP_569919.2 PMP22_Claudin 39..211 CDD:304458 44/232 (19%)
Cldnd1XP_006248268.1 PMP22_Claudin 40..257 CDD:304458 44/234 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003948
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.