DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pck and LOC101731523

Sequence 1:NP_569919.2 Gene:pck FlyBaseID:FBgn0013720 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_004920839.1 Gene:LOC101731523 ID: Length:105 Species:Xenopus tropicalis

Alignment Length:105 Identity:21/106 (20%)
Similarity:44/106 (42%) Gaps:27/106 (25%)


  Fly    32 GAIVTFASFFVLMMSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIFSH 96
            |.:.......:|:::..:.:|:: |..: .:..|.|||::|    |..|         ||   :|
 Frog     8 GLLCAVCGLVLLIVATATDFWMQ-YRYS-GNLSNQGLWRFC----VAGK---------CH---AH 54

  Fly    97 EYYVIREYLLPGWLMAVQGFVTMSFIIVF--LVLALLSLT 134
            ...|       .:..|.:.|:.:|.:..|  ::|.|.:.:
 Frog    55 TITV-------AFWDATRAFMLLSILSSFAGIILGLTAFS 87

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pckNP_569919.2 PMP22_Claudin 39..211 CDD:304458 20/99 (20%)
LOC101731523XP_004920839.1 PMP22_Claudin 1..>105 CDD:304458 21/106 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1279397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.