DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pck and LOC100487261

Sequence 1:NP_569919.2 Gene:pck FlyBaseID:FBgn0013720 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_017945127.1 Gene:LOC100487261 ID: Length:557 Species:Xenopus tropicalis

Alignment Length:188 Identity:42/189 (22%)
Similarity:74/189 (39%) Gaps:51/189 (27%)


  Fly    30 VFGAIVTFASFFVLMMSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIF 94
            |.|.|::.||...::....:.||:..:.|   ...:.||||.|.|:..|       |.:|     
 Frog     6 VIGIILSCASLIFILTGLLTDYWLVDFGE---KLSHQGLWQICSKNVCY-------QLSG----- 55

  Fly    95 SHEYYVIREYLLPGWLMAVQGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQYEWLLV------RL 153
                        .|:|.|.:|.|..|       .|||.|.::    .|.|.:..|.|      .|
 Frog    56 ------------SGFLGATRGLVIFS-------TALLLLGMV----SACLSFNNLSVGKITASLL 97

  Fly   154 SYMGTAISSLFMFLAVCIFGGCAYRRDWMMYPKFNVLG--WSYALAVVTFMLLGLAAL 209
            :.|...::.:|:.:.:.::.|     :.:.:.....|.  ||:.|..|...:|.:::|
 Frog    98 AAMLKILAGIFLLIGMSVYTG-----ETVSFVNNGSLNYQWSFYLCWVAVFMLFISSL 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pckNP_569919.2 PMP22_Claudin 39..211 CDD:304458 38/180 (21%)
LOC100487261XP_017945127.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1279397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.