DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MNX1 and Antp

Sequence 1:NP_005506.3 Gene:MNX1 HGNCID:4979 Length:401 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:279 Identity:85/280 (30%)
Similarity:108/280 (39%) Gaps:86/280 (31%)


Human    86 AHCALLPKPGFLGAGGGGGG------TGGGHGG-----PHHHAHPGAAAAAAAAAAAAAAGGLAL 139
            |.|.|....|.||....||.      ..|.|..     |||..||           .|..|...:
  Fly   160 ASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHP-----------QAQLGYTDV 213

Human   140 GL-----------HPGGAQGGAGLPAQAALYGHPVYGYSAAAAAAALAGQHPALSYSYPQVQGAH 193
            |:           :.|..|..:|:|.    .|.|..|...       .||.|      ||:...|
  Fly   214 GVPDVTEVHQNHHNMGMYQQQSGVPP----VGAPPQGMMH-------QGQGP------PQMHQGH 261

Human   194 PAHPADPIKLGAGTFQLDQWLRASTAGMILPKMPDFNSQAQSNLLGKC---RRPRTAFTSQQLLE 255
            |.....|          .|...:.::||..|..|...||     .|||   :|.|..:|..|.||
  Fly   262 PGQHTPP----------SQNPNSQSSGMPSPLYPWMRSQ-----FGKCQERKRGRQTYTRYQTLE 311

Human   256 LEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGA 320
            ||.:|..|:||:|.:|.|:|.:|.|||.|:||||||||||||:..|.|.:.         |.||.
  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEP---------GSGGE 367

Human   321 GKGGAEEPGAEELLGPPAP 339
            |         :|:..|.:|
  Fly   368 G---------DEITPPNSP 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MNX1NP_005506.3 Homeobox 244..297 CDD:278475 31/53 (58%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.