DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MNX1 and unpg

Sequence 1:NP_005506.3 Gene:MNX1 HGNCID:4979 Length:401 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:398 Identity:107/399 (27%)
Similarity:139/399 (35%) Gaps:150/399 (38%)


Human     5 KNFRIDALLAVDPPRAASAQSAP--------------LALVTSLAAAASGTGGGGGGGGASGGT- 54
            |.|.|::|:|...|..|:..|.|              |:....:|::|.|.            | 
  Fly    29 KPFSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGL------------TQ 81

Human    55 -----------------------SGSC----SPASSEPPAAPADRLRAESPSPPRLLAAHC---- 88
                                   :|.|    |||..  |||...:.:|:...||.....|.    
  Fly    82 FPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGH--PAAQQPQAQAQPQPPPPHPPTHALEKQ 144

Human    89 --ALLPKP---GFLGAGGGGGGTGGGHGGPHHHAHPGAAAAAAAAAAAAAAGGLA---------- 138
              ..||.|   .||                     |...|||..|....:...||          
  Fly   145 LPPTLPHPLDTRFL---------------------PFNPAAAGVAPTDLSYRRLAELMNQDYVHS 188

Human   139 LGLHPGGAQGGAGLPAQAALYGHPVYGYSAAAAAAALAGQHPALSYSYPQVQGAH-PAHPADPIK 202
            |.:|       |.|...||  ...::...|....|.|....|..::|.|...|:| |..||    
  Fly   189 LSVH-------ARLQHMAA--AGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPA---- 240

Human   203 LGAGTFQLDQWLRASTAGMILPKMP-DFNSQ----------------------AQSNLLG----- 239
            |..|..:..:....|.:.:.|...| ::|.:                      |||...|     
  Fly   241 LDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG 305

Human   240 ------------KCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNR 292
                        |.||.||||||:||||||.:|...||||..:|.::||||.|:|.|||||||||
  Fly   306 KDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNR 370

Human   293 RMKWKRSK 300
            |.||||.|
  Fly   371 RAKWKRVK 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MNX1NP_005506.3 Homeobox 244..297 CDD:278475 36/53 (68%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.