powered by:
                   
 
    
    
             
          
            Protein Alignment CG14785 and KLHL31
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_569912.2 | Gene: | CG14785 / 31094 | FlyBaseID: | FBgn0027795 | Length: | 470 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001003760.2 | Gene: | KLHL31 / 401265 | HGNCID: | 21353 | Length: | 634 | Species: | Homo sapiens | 
        
        
        
          
            | Alignment Length: | 183 | Identity: | 38/183 - (20%) | 
          
            | Similarity: | 62/183 -  (33%) | Gaps: | 44/183 - (24%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly   275 FLCIVGSPFFLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWLEHNWLERGDCAERILAEVHFAL 339||....|..|:..|..::..:|.:..|.:.|||..|...:.|||.: .:|...|..:|:.:.|..
 Human   199 FLEFAESDQFMKLTFEQINELLIDDDLQLPSEIVAFQIAMKWLEFD-QKRVKYAADLLSNIRFGT 262
 
 
  Fly   340 MPTWYLCTLDRSNRCNHFARVIHSPGVQRL-----------------------IAAGLEDAITLK 381:...|..|......|::......||                       |..|....:|:.
 Human   263 -----ISAQDLVNYVQSVPRMMQDADCHRLLVDAMNYHLLPYHQNTLQSRRTRIRGGCRVLVTVG 322
 
 
  Fly   382 SKPRFSGAALHRQRKHQEERLLVRD----WIVDTECSHHHKSHC----EQFVY 426.:|..:..:|.|.       :|.||    |...||......:.|    :.|:|
 Human   323 GRPGLTEKSLSRD-------ILYRDPENGWSKLTEMPAKSFNQCVAVMDGFLY 368
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            | User_Submission | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 1 | 0.910 |  | 
        
      
           
             Return to query results.
             Submit another query.