DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14785 and KLHL31

DIOPT Version :9

Sequence 1:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001003760.2 Gene:KLHL31 / 401265 HGNCID:21353 Length:634 Species:Homo sapiens


Alignment Length:183 Identity:38/183 - (20%)
Similarity:62/183 - (33%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 FLCIVGSPFFLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWLEHNWLERGDCAERILAEVHFAL 339
            ||....|..|:..|..::..:|.:..|.:.|||..|...:.|||.: .:|...|..:|:.:.|..
Human   199 FLEFAESDQFMKLTFEQINELLIDDDLQLPSEIVAFQIAMKWLEFD-QKRVKYAADLLSNIRFGT 262

  Fly   340 MPTWYLCTLDRSNRCNHFARVIHSPGVQRL-----------------------IAAGLEDAITLK 381
                 :...|..|......|::......||                       |..|....:|:.
Human   263 -----ISAQDLVNYVQSVPRMMQDADCHRLLVDAMNYHLLPYHQNTLQSRRTRIRGGCRVLVTVG 322

  Fly   382 SKPRFSGAALHRQRKHQEERLLVRD----WIVDTECSHHHKSHC----EQFVY 426
            .:|..:..:|.|.       :|.||    |...||......:.|    :.|:|
Human   323 GRPGLTEKSLSRD-------ILYRDPENGWSKLTEMPAKSFNQCVAVMDGFLY 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14785NP_569912.2 BACK 256..345 CDD:197943 18/69 (26%)
DUF4734 360..450 CDD:292506 17/98 (17%)
KLHL31NP_001003760.2 BTB 63..164 CDD:279045
PHA03098 73..601 CDD:222983 38/183 (21%)
BACK 172..273 CDD:285009 20/79 (25%)
Kelch 1 317..365 11/54 (20%)
KELCH repeat 356..405 CDD:276965 3/13 (23%)
Kelch 2 366..419 2/3 (67%)
Kelch 367..419 CDD:128874 1/2 (50%)
KELCH repeat 409..453 CDD:276965
Kelch 420..466 CDD:128874
Kelch 3 420..466
Kelch_1 455..500 CDD:279660
KELCH repeat 456..501 CDD:276965
Kelch 4 468..513
Kelch_1 502..552 CDD:279660
KELCH repeat 503..551 CDD:276965
Kelch 5 515..565
KELCH repeat 555..602 CDD:276965
Kelch 6 567..614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.