DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14785 and CG10752

DIOPT Version :9

Sequence 1:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_648614.1 Gene:CG10752 / 39467 FlyBaseID:FBgn0036325 Length:539 Species:Drosophila melanogaster


Alignment Length:321 Identity:66/321 - (20%)
Similarity:134/321 - (41%) Gaps:61/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 AIERVSEQLLHVLREQTLMEAGIFVGNERYRFFKGVLQNYAKIYA---ARKFIDKLPKLDQLGPD 206
            |:||......:::...|:.:..:|           ||:.|.|::.   .|..|.|.|:      |
  Fly    58 ALERNIGPHAYIIVNDTIYKCQVF-----------VLRIYCKLFTNNLKRGDIVKFPR------D 105

  Fly   207 AGAER-------------------ELFARVVAEEVLQIPQLLRQLRSSLSKMEFFNEDTAFKAYL 252
            |.:..                   ::...:.|.:.||...|::::...|:......|..:|..||
  Fly   106 AMSNECFELAYTWMTNNAIHLPRDKIINLLAAAKCLQCIPLIKRIFEFLNDYRTHCELFSFSCYL 170

  Fly   253 EVRYHPQARILCELMLTRISRVFLCIVGSPFFLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWL 317
            :.:.....:: .::|::|:::.||.:|.:..|:.........:||:.:|:|.:|||||.|.:|||
  Fly   171 KAKDMGMTQV-ADMMVSRVTKSFLVLVSNGQFIKMDIDGACTLLRSRHLAVQNEIEIFYSALLWL 234

  Fly   318 EHNWLERGDCAERILAEVHFALMPTWYLCTLDRSNRCNHFARVIHSPGVQRLIAAGLEDAITLKS 382
            ..|:..|.....|:|:.|.|.::|..::  |..::.....     .|.:..::...|.:|:..:.
  Fly   235 ISNYEMRIKYIPRVLSLVRFLMIPAVFI--LQWTSNLKDL-----RPELANVLCHFLHNAMLSQF 292

  Fly   383 KPRFSGAALHRQRKHQEERLL--VRDWIVDTECSH--HHKSHCEQFVYPTYDAFKEYLARI 439
            :        :.....|.|.::  .|.|..|.:|.:  ...::.:..:.|  |.|..||.:|
  Fly   293 E--------YYTETFQSESIIRGNRRWAQDPQCPYLSLFNANGDSDLSP--DVFFRYLRQI 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14785NP_569912.2 BACK 256..345 CDD:197943 26/88 (30%)
DUF4734 360..450 CDD:292506 15/84 (18%)
CG10752NP_648614.1 BACK 172..264 CDD:197943 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.