DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14785 and kel-3

DIOPT Version :8

Sequence 1:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_499784.2 Gene:kel-3 / 176775 WormBaseID:WBGene00002185 Length:591 Species:Caenorhabditis elegans

Alignment Length:146 Identity:35/147 (24%)
Similarity:62/147 (42%) Gaps:25/147 (17%)


  Fly   231 QLRSSLSKMEFFNEDTAFKAYLEV----------RYHP----QARILCELMLTR----------I 271
            :||.:.|.::.......|...|||          |.||    ..|..|::|...          |
 Worm   115 ELRITTSNVQSIMLGANFFQMLEVVQHCGNFLLTRLHPSNALSIREFCKMMCVEEKITEMTDDYI 179

  Fly   272 SRVFLCIVGSPFFLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWLEHNWLERGDCAERILAEVH 336
            .:.|:.:.....|...:..:...:|||.:|.|:||.:::::.:.||..:.: |.:.|.:||..|.
 Worm   180 QKHFMAVSKDEDFKRLSLEDAIELLRNDHLYVDSEEQVYVAAMEWLNCDVI-RHEQAAKILPCVR 243

  Fly   337 FALMPTWYLCTLDRSN 352
            ..|:...||.::..||
 Worm   244 LPLLSPTYLSSIVASN 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14785NP_569912.2 BACK 256..345 CDD:197943 24/103 (23%)
DUF4734 360..450 CDD:292506
kel-3NP_499784.2 BTB 41..147 CDD:279045 7/32 (22%)
PHA03098 51..568 CDD:222983 35/147 (24%)
BACK 155..257 CDD:285009 23/103 (22%)
Kelch 304..350 CDD:128874
KELCH repeat 341..384 CDD:276965
Kelch 352..396 CDD:128874
KELCH repeat 388..431 CDD:276965
Kelch 399..445 CDD:128874
KELCH repeat 435..479 CDD:276965
Kelch 446..492 CDD:128874
KELCH repeat 482..527 CDD:276965
Kelch 493..539 CDD:128874
KELCH repeat 529..572 CDD:276965
Kelch 541..584 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.