DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and PAB8

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001185184.1 Gene:PAB8 / 841399 AraportID:AT1G49760 Length:671 Species:Arabidopsis thaliana


Alignment Length:501 Identity:127/501 - (25%)
Similarity:187/501 - (37%) Gaps:133/501 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNADKMQDQEHDDEQSS------DIEGSGDNVGRDDG-----TDDDDDSNGNMQQENGDGGNGG 54
            :.|.||..|.:...|..|      ..:.:.|..|:..|     .|.|:.:.|.:.:.||...|  
plant   137 IKNLDKSIDHKALHETFSAFGPILSCKVAVDPSGQSKGYGFVQYDTDEAAQGAIDKLNGMLLN-- 199

  Fly    55 DGQEHSGDEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPI 119
            |.|.:.|.......:|..|              ::...||:.:..|.:.::|.||..:|...|..
plant   200 DKQVYVGPFVHKLQRDPSG--------------EKVKFTNVYVKNLSESLSDEELNKVFGEFGVT 250

  Fly   120 NTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNG-------FYV--------RNKRLKVSYA 169
            .:|.||||.: |.|.|:|||:::...|:..|:..|||       ::|        |...||..:.
plant   251 TSCVIMRDGE-GKSKGFGFVNFENSDDAARAVDALNGKTFDDKEWFVGKAQKKSERETELKQKFE 314

  Fly   170 RPGGQSIKD-------TNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRY 227
                ||:|:       :||||.||..::.||.|...|:|:|.|....::||. :|..||..||.:
plant   315 ----QSLKEAADKSQGSNLYVKNLDESVTDDKLREHFAPFGTITSCKVMRDP-SGVSRGSGFVAF 374

  Fly   228 NKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKA---AQFMAQIGGGNGGGGGGPPHMGPG 289
            :..|||..||..:|..:..  ::|::|.||:.....||   ||| :|:...|     .||.:||.
plant   375 STPEEATRAITEMNGKMIV--TKPLYVALAQRKEDRKARLQAQF-SQMRPVN-----MPPAVGPR 431

  Fly   290 GPMHPPHHHNNHHHNNHHNPHMPPHHHQPQH----PHQHPQHHPQLHHMQHHHPNNHNNNHP--- 347
            ..|:||..              ||...|..:    |...||  |...:.|...|.......|   
plant   432 MQMYPPGG--------------PPMGQQLFYGQGPPAMIPQ--PGFGYQQQLVPGMRPGGSPMPN 480

  Fly   348 -------NNHHHNNNNNNHHNMGG-----------PHPHHMQQMHPMG---------MNMGMGVN 385
                   ...............||           |.|...|||||.|         :|...|..
plant   481 FFMPMMQQGQQQQQQQQQQQRPGGGRRGALPQPQQPSPMMQQQMHPRGRMYRYPQRDVNTMPGPT 545

  Fly   386 MGMGMGMGMPIHGGGGGGGGGGGGGGGGNFHHMAHRGEVFMLPLPI 431
            ..|   :.:|.....|||              :.||......|:||
plant   546 QNM---LSVPYDVSSGGG--------------VHHRDSPTSQPVPI 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 28/94 (30%)
RRM_SF 179..257 CDD:302621 28/77 (36%)
PAB8NP_001185184.1 PABP-1234 46..646 CDD:130689 127/501 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.