DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and GR-RBP3

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001330940.1 Gene:GR-RBP3 / 836224 AraportID:AT5G61030 Length:309 Species:Arabidopsis thaliana


Alignment Length:267 Identity:63/267 - (23%)
Similarity:89/267 - (33%) Gaps:121/267 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 NKRL--KVSYARPG-GQSIK---DTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRP 219
            ||:|  :||.:.|. .|:|:   .:.|::..::.::::|.|...|:.||.:|...::.|:.|||.
plant    16 NKQLNAQVSLSSPSLFQAIRCMSSSKLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRS 80

  Fly   220 RGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQI-------GGGNG 277
            ||..||.:...|.|..||:||:.              .:.||:.....:....       |||.|
plant    81 RGFGFVTFTSSEAASSAIQALDG--------------RDLHGRVVKVNYANDRTSGGGFGGGGYG 131

  Fly   278 GGGGGPPHMGPGGPMHPPHHHNNHHHNNHHNPHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPNNH 342
            |||||  :.|.||                                                    
plant   132 GGGGG--YGGSGG---------------------------------------------------- 142

  Fly   343 NNNHPNNHHHNNNNNNHHNMGGPHPHHMQQMHPMGMNMGMGVNMGMGMGMGMPIHGGGGGGGGGG 407
                               .||                |.|...|.| |.|    ||.||.||..
plant   143 -------------------YGG----------------GAGGYGGSG-GYG----GGAGGYGGNS 167

  Fly   408 GGGGGGN 414
            |||.|||
plant   168 GGGYGGN 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 6/14 (43%)
RRM_SF 179..257 CDD:302621 21/77 (27%)
GR-RBP3NP_001330940.1 RRM2_NsCP33_like 41..116 CDD:410187 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.