DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and CELF5

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_068757.2 Gene:CELF5 / 60680 HGNCID:14058 Length:485 Species:Homo sapiens


Alignment Length:219 Identity:59/219 - (26%)
Similarity:103/219 - (47%) Gaps:29/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFG 135
            :.|.:...||...|:.:|   |..|.:..:|:.:.:::|..||...|.|....:::|..||...|
Human    26 SSGPEPPGGQPDGMKDLD---AIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKG 87

  Fly   136 YGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARP-----------GGQSIKDTNLYVINLSRN 189
            ..|:.|.....:..|...|:     .::.....|||           ||   :|..|:|..|::.
Human    88 CAFLTYCARDSAIKAQTALH-----EQKTLPGMARPIQVKPADSESRGG---RDRKLFVGMLNKQ 144

  Fly   190 INDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKAL--NNTVPEGGSQPI 252
            .:::.:.|:|.|:|:|.:..:||.. .|..:|.|||:::...|||.||.||  :.|:| |.|..:
Human   145 QSEEDVLRLFQPFGVIDECTVLRGP-DGSSKGCAFVKFSSHTEAQAAIHALHGSQTMP-GASSSL 207

  Fly   253 WVRLAE---EHGKAKAAQFMAQIG 273
            .|:.|:   |....:..|.:.|:|
Human   208 VVKFADTDKERTLRRMQQMVGQLG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 18/90 (20%)
RRM_SF 179..257 CDD:302621 27/79 (34%)
CELF5NP_068757.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 3/13 (23%)
RRM1_CELF3_4_5_6 40..126 CDD:410041 20/93 (22%)
half-pint 46..>372 CDD:130706 53/196 (27%)
RRM2_CELF3_4_5_6 133..213 CDD:410043 28/81 (35%)
RRM3_CELF3_4_5_6 396..474 CDD:241083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.